| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN001 |
692..1834 |
dnaN |
g1673814 |
K05_orf380 |
conf, DNA polymerase III beta subunit |
  |
2POL-A |
cell division |
MG001 |
  |
lc: 2..22; |
sub: DNA polymerase III |
MP153 |
complement(203967..205109) |
| MPN002 |
1838..2767 |
xdj1 |
g1673813 |
K05_orf309 |
more__, similar to j-domain of DnaJ |
1-77, j-domain of DnaJ; rest only homologs MP/MG |
1HDJ |
cell division (?) cochaperon (?) possible activation of DnaK |
MG002 |
MPN119, MPN048, MPN021 |
  |
sub: heat_shock (I); needs DNAK; caution! may be it is not at all working as DnaJ; new_conf known for MG homolog 94364962 J Bacteriol 1994 Sep 176:18 5814-9 "contains a DnaJ box motif at its N terminus, but it has no overall homology to any other protein or sequence in the database"; unconnected; less: not a DnaJ but likely to activate DnaK as it contains the j-domain of DnaJ; exp: 94149015 _ECOLI; By position (between dnaN and gyrB, a position where recF - not present in MP - normally seats) it maybe transcribed together with cell division proteins and therefore it must have a related functional role. |
MP152 |
complement(203034..203963) |
| MPN003 |
2869..4821 |
gyrB |
g1673811 |
K05_orf650 |
conf, DNA gyrase subunit B |
  |
1BGW, 1AJ6 |
cell division |
MG003 |
MPN122 |
lc: 395..407; |
sub: DNA gyrase |
MP151 |
complement(200980..202932) |
| MPN004 |
4821..7340 |
gyrA |
g1673810 |
K05_orf839o |
conf, DNA gyrase subunit A |
  |
1AB4 |
cell division |
MG004 |
MPN123 |
cc: 1..25 445..487; lc: 709..722 752..765 816..829; |
sub: DNA gyrase |
MP150 |
complement(198461..200980) |
| MPN005 |
7312..8574 |
serS |
g1673809 |
D12_orf420 |
conf, seryl-tRNA synthetase |
  |
1SER-A |
  |
MG005 |
  |
cc: 66..99; |
exp:_ecoli, 87146412 |
MP149 |
complement(197227..198489) |
| MPN006 |
8579..9211 |
D12_orf210 |
g1673808 |
D12_orf210 |
conf, thymidylate kinase |
  |
1TMK-A |
Nucleotide and deoxynucleotide degradation or rescue reaction; thymidylate kinase; NTP + Thymidin = NDP + TMP. |
MG006 |
  |
  |
exp:_yeast, 84289538 |
MP148 |
complement(196590..197222) |
| MPN007 |
9184..9945 |
holB |
g1673807 |
D12_orf253 |
less, similar to DNA-polymerase subunits |
  |
1A5T |
  |
MG007 |
MPN618 |
lc: 178..191; |
sub: DNA polymerase III; less, no sufficient significance for subunit delta prime; |
MP147 |
complement(195856..196617) |
| MPN008 |
9947..11275 |
thdF |
g1673806 |
D12_orf442 |
conf, thiophene and furan oxidation protein |
  |
1EFT |
  |
MG008 |
MPN656, MPN568, MPN481, MPN475 |
  |
exp:_ecoli, 92011358 |
MP146 |
complement(194526..195854) |
| MPN009 |
11275..12060 |
yabD |
g1673805 |
D12_orf261 |
new_conf, hydrolase |
  |
  |
  |
MG009 |
  |
  |
new_conf Koonin: metal utilizing enzyme (homolog MG) similar to other hydrolases; unconnected; is really hypothetical, RNA data from ZMBH, no expression in 3 diff experiments, not expressed; |
MP145 |
complement(193741..194526) |
| MPN010 |
12257..12652 |
D12_orf131 |
g1673804 |
D12_orf131 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF; exp: RNA data from ZMBH, RNA-expressed; |
MP144 |
complement(193149..193544) |
| MPN011 |
complement(12838..13533) |
D12_orf231 |
g1673803 |
D12_orf231 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN148, MPN054, MPN012, MPN654, MPN650, MPN649, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN271, MPN173 |
sp: 1..22; |
  |
MP143 |
192268..192963 |
| MPN012 |
complement(13558..14265) |
D12_orf235 |
g1673802 |
D12_orf235 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN148, MPN054, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN271 |
sp: 1..21; |
  |
MP142 |
191536..192243 |
| MPN013 |
14992..15765 |
D12_orf257 |
g1673801 |
D12_orf257 |
hypothetical |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 199..255; lc: 67..91 97..114; |
Note that this whole family occurs only in M.pneumoniae, it is the DUF16 family (pfam); so it is not conserved between species, only occurs in different homologues in M.pneumoniae exp: RNA data from ZMBH, RNA-expressed; |
MP141 |
complement(190036..190809) |
| MPN014 |
15867..16505 |
dnaE |
g1673800 |
D12_orf212 |
conserved hypothetical |
  |
  |
  |
MG010 |
MPN353 |
  |
only similar to the middle part of DNA-primase MP; exp: RNA data from ZMBH found only once at 32 degrees an mRNA, doubtful; |
MP140 |
complement(189296..189934) |
| MPN015 |
complement(16482..17339) |
D12_orf285 |
g1673799 |
D12_orf285 |
conserved hypothetical |
  |
1JDB-B |
  |
MG011 |
MPN016 |
  |
similar to MP138 |
MP139 |
188462..189319 |
| MPN016 |
complement(17339..18205) |
rimK |
g1673798 |
D12_orf288 |
conf, similar to ribosomal S6 modification protein |
  |
1JDB-B |
  |
MG012 |
MPN015 |
  |
SUB; similar to ribosomal S6 modification protein ECOLI (89364710) |
MP138 |
187596..188462 |
| MPN017 |
complement(18180..18989) |
mtd1 |
g1673797 |
D12_orf269 |
conf, 5,10-methylene-tetrahydrofolate dehydrogenase |
  |
  |
Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; 5,10-methylene-tetrahydrofolate dehydrogenase; 5,10-methylenetetrahydrofolate + NAD(P) = 5,10-methenyltetrahydrofolate + NAD(P)H |
MG013 |
  |
lc: 146..156; |
homodimer; biosynthesis |
MP137 |
186812..187621 |
| Ala-tRNA(GCA) |
complement(19074..19149) |
  |
  |
  |
in Genbank, "gene" missing. Maybe gene = "mptgi" |
  |
  |
  |
  |
  |
  |
  |
complement(19074..19149) |
186652..186727 |
| Ile-tRNA(ATC) |
complement(19155..19231) |
mptgi |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(19155..19231) |
186570..186646 |
| MPN018 |
19325..21196 |
pmd1 |
g1673795 |
D12_orf623 |
conf, transport ATP-binding protein |
16-315, ABC_membrane (Pfam) 393-587, ABC_tran (Pfam) |
  |
Transporter, ABC superfamily; drug efflux |
MG014 |
MPN134, MPN081, MPN055, MPN019, MPN685, MPN683, MPN609, MPN433, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
sp: 1..25; tm: 31..51 84..104 181..201 267..287 312..332; lc: 476..493; |
Paulsen: ABC superfamily, membrane, drug efflux |
MP136 |
complement(184605..186476) |
| MPN019 |
21108..23012 |
msbA |
g1673794 |
D12_orf634 |
conf, transport ATP-binding protein |
54-345, ABC_membrane (Pfam) 423-607, ABC_tran (Pfam) |
  |
Transporter, ABC superfamily; drug efflux |
MG015 |
MPN134, MPN081, MPN055, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
tm: 54..74 111..131 190..210 213..233 293..313 325..345; |
Paulsen: ABC superfamily, membrane, drug efflux |
MP135 |
complement(182789..184693) |
| MPN020 |
23022..26114 |
yb95 |
g1673793 |
D12_orf1030 |
conf, similar to helicases |
581-848, SNF2_N (Pfam) 892-975, helicase_C (Pfam) |
1A1V-A |
  |
MG016; MG017; MG018 |
  |
  |
exp: RNA data from ZMBH, 2x at 32 degrees, RNA-expressed; |
MP134 |
complement(179687..182779) |
| MPN021 |
26160..27332 |
dnaJ |
g1673792 |
D12_orf390o |
conf, heat shock protein DnaJ |
  |
1HDJ |
cochaperon; activator of DnaK |
MG019 |
MPN119, MPN002 |
lc: 262..275; |
sub:hsp70 with DnaK (MP407) and GrpE (MP034) |
MP133 |
complement(178469..179641) |
| MPN022 |
27316..28245 |
pip |
g1673791 |
B01_orf309 |
conf, proline iminopeptidase |
  |
1BE0 |
  |
MG020 |
  |
  |
exp:_neigo, 95020651 |
MP132 |
complement(177556..178485) |
| MPN023 |
28245..29783 |
metS |
g1673790 |
B01_orf512 |
conf, methionyl-tRNA synthetase |
  |
1GLN |
  |
MG021 |
MPN520, MPN480, MPN384 |
  |
homodimer; translation |
MP131 |
complement(176018..177556) |
| MPN024 |
29804..30244 |
rpoE |
g1673789 |
B01_orf146 |
conf, DNA-directed RNA polymerase delta subunit |
  |
  |
  |
MG022 |
  |
  |
sub: transcription; exp:_bacsu, 88329737 |
MP130 |
complement(175557..175997) |
| MPN025 |
30244..31110 |
tsr |
g1673788 |
B01_orf288 |
conf, fructose-bisphosphate aldolase |
  |
1DOS-A |
Energy metabolism, Glycolysis; fructose-bisphosphate aldolase; fructose 1,6-bisphosphate = glycerone phosphate + D-glyceraldehyde 3-phosphate; |
MG023 |
  |
  |
homodimer |
MP129 |
complement(174691..175557) |
| MPN026 |
31111..32199 |
yyaF |
g1673787 |
B01_orf362 |
new_conf, similar to GTPases |
  |
1DAR |
  |
MG024 |
MPN563 |
lc: 186..195; |
new_conf Koonin: GTPase; unconnected; exp: RNA data from ZMBH, RNA-expressed; |
MP128 |
complement(173602..174690) |
| MPN027 |
complement(32202..33026) |
B01_orf274 |
g1673786 |
B01_orf274 |
hypothetical |
  |
  |
  |
  |
  |
  |
This protein has no relatives. exp: RNA data from ZMBH, RNA-expressed; Is is suggested (Ake Wieslaender, university of Stockholm) that this protein tentatively may be some kind of transcription regulator |
MP127 |
172775..173599 |
| MPN028 |
33059..33958 |
trsB |
g1673785 |
B01_orf299V |
conf, sugar transferase |
  |
  |
  |
MG025 |
MPN075, MPN483, MPN238 |
  |
probable beta-glycosyltransferase trsB - Yersinia enterocolitica was meant with the old assignment; would easy lead to a wrong_ Koonin: similar to RfbV (enzyme?) trsb may however have no meaning for non-specialist or leads in completely other directions (trsb gene in virusses or for recombination) |
MP126 |
complement(171843..172742) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN029 |
33979..34551 |
efp |
g1673784 |
B01_orf190 |
conf, elongation factor P |
  |
1BKB |
  |
MG026 |
  |
  |
sub: translation; |
MP125 |
complement(171250..171822) |
| MPN030 |
34469..34975 |
B01_orf168 |
g1673783 |
B01_orf168 |
conserved hypothetical |
  |
  |
  |
MG027 |
  |
sp: 1..20; |
  |
MP124 |
complement(170826..171332) |
| MPN031 |
34975..35586 |
B01_orf203 |
g1673782 |
B01_orf203 |
conserved hypothetical |
  |
  |
  |
MG028 |
  |
sp: 1..29; tm: 42..62 86..106 127..147; |
exp: RNA data from ZMBH, but only once at 32 degree, remain sceptical. |
MP123 |
complement(170215..170826) |
| MPN032 |
complement(35810..36136) |
B01_orf108 |
g1673781 |
B01_orf108 |
new_conf, hydrolase |
  |
1IPH-A |
  |
MG029 |
  |
  |
new_conf, similar to other hydrolases exp:_pyrfu; exp: RNA data from ZMBH, RNA-expressed; latest versioin of COG693 suggsests a protease/amidase; hydrolase is meant as being less specific on the function, protease is not sure by the sequence evidence, but plausible. |
MP122 |
169665..169991 |
| MPN033 |
complement(36140..36760) |
upp |
g1673780 |
B01_orf178 |
conf, uracil phosphoribosyltransferase |
  |
  |
Purines, pyrimidines, nucleosides and nucleotides; Salvage of nucleosides and nucleotides; uracil phosphoribosyltransferase; UMP + pyrrophosphatete = Uracile + phosphoribosylpyrrophosphate.. |
MG030 |
MPN073 |
tm: 96..116; |
new compared to Bairoch: In P75081 still considered to start at MALSQITSLL ...; but now updated, 15.2.2000; |
MP121 |
169125..169661 |
| MPN034 |
complement(36800..41131) |
polC |
g1673778 |
B01_orf1443 |
conf, DNA polymerase III (dnaE) alpha chain |
  |
  |
  |
MG031 |
MPN378 |
  |
sub: DNA polymerase III; |
MP120 |
164670..169001 |
| MPN035 |
41409..43409 |
B01_orf666 |
g1673777 |
B01_orf666 |
conserved hypothetical see: MP118 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN041, MPN039, MPN036, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 |
sp: 1..22; cc: 323..371; |
exp: No expression (3 measurements), is not expressed ! |
MP119 |
complement(162392..164392) |
| MPN036 |
43581..45602 |
B01_orf673 |
g1673776 |
B01_orf673 |
conserved hypothetical |
  |
  |
  |
MG032 |
MPN049, MPN048, MPN042, MPN041, MPN039, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 |
sp: 1..30; cc: 313..376; lc: 130..143; |
exp: RNA data from ZMBH, RNA-expressed; |
MP118 |
complement(160199..162220) |
| MPN037 |
45770..46213 |
B01_orf147 |
g1673775 |
B01_orf147 |
hypothetical see: MP376 |
  |
  |
  |
  |
MPN676, MPN465 |
tm: 11..31 40..60 75..95; lc: 133..145; |
MP specific exp: RNA data from ZMBH, RNA-expressed; |
MP117 |
complement(159588..160031) |
| MPN038 |
complement(46442..46792) |
B01_orf116L |
g1673774 |
B01_orf116L |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP116 |
159009..159359 |
| MPN039 |
47194..48210 |
B01_orf338 |
g1673773 |
B01_orf338 |
conserved hypothetical see: MP118 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN036, MPN035, MPN512, MPN510, MPN509, MPN508, MPN234 |
sp: 1..23; |
exp: RNA data from ZMBH, RNA-expressed; |
MP115 |
complement(157591..158607) |
| MPN040 |
complement(48105..48416) |
B01_orf103b |
g1673772 |
B01_orf103b |
conserved hypothetical |
  |
  |
  |
  |
  |
sp: 1..45; lc: 46..75; |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP114 |
157385..157696 |
| MPN041 |
48670..49230 |
B01_orf186L |
g1673771 |
B01_orf186L |
conserved hypothetical see: MP118 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN036, MPN035, MPN673, MPN511, MPN510, MPN509, MPN508 |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP113 |
complement(156571..157131) |
| MPN042 |
49292..51310 |
B01_orf672 |
g1673769 |
B01_orf672 |
conserved hypothetical see: MP118 |
  |
  |
  |
  |
MPN049, MPN048, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 |
sp: 1..28; cc: 102..125 319..366; |
exp: RNA data from ZMBH, RNA-expressed; |
MP112 |
complement(154491..156509) |
| MPN043 |
51634..52428 |
glpF |
g1673768 |
B01_orf264 |
conf, glycerol uptake facilitator |
  |
  |
transporter, ion channels; note that this can also transport e.g. urea and polyols; |
MG033 |
  |
tm: 13..33 49..69 102..122 165..185 193..213; |
Paulsen: Ion channel, MIP, glycerol |
MP111 |
complement(153373..154167) |
| MPN044 |
complement(52475..53050) |
tdk |
g1673767 |
B01_orf191 |
conf, thymidine kinase |
  |
  |
Purines, pyrimidines, nucleosides and nucleotides; Salvage of nucleosides and nucleotides; thymidine kinase; ATP + thymidine = ADP + thymidine5Phosphate. |
MG034 |
  |
  |
exp: 2D-Gel data from ZMBH Ges., MW 24kD, IEP ca. 8.9 |
MP110 |
152751..153326 |
| MPN045 |
53077..54321 |
hisS |
g1673766 |
B01_orf414o |
conf, histidyl-tRNA synthetase |
  |
1HTT-A |
  |
MG035 |
  |
lc: 232..247; |
homodimer; translation |
MP109 |
complement(151480..152724) |
| MPN046 |
54293..55966 |
aspS |
g1673765 |
D09_orf557 |
conf, aspartyl-tRNA synthetase |
  |
1ASY-A |
  |
MG036 |
MPN277, MPN252, MPN214 |
  |
  |
MP108 |
complement(149835..151508) |
| MPN047 |
55942..57297 |
D09_orf451 |
g1673764 |
D09_orf451 |
new_conf, similar to nicotinate phosphoribosyl transferase |
  |
  |
cofactor metabolism; nicotinate + 5-PRPP = nicotinate-ribonucleotide + PPi |
MG037 |
  |
  |
new_conf; however, just sequence similarity; similar to NICOTINATE PHOSPHORIBOSYLTRANSFERASE;would also explain how NAD is created in MP, as there is only nicotinate imported; seems more likely than the horizontal transfer story of a pre-B-cell factor; psi blast search from the putative human factor converges and finds only homologues from SY and MP,MG; the paper reports only ill chracterized factor; on the other hand psi-blast search with MP107 brings within 2 iterations whole family up and several times relation to nicotinate phosphoribosyl transferases; described also in updated COG1488 |
MP107 |
complement(148504..149859) |
| MPN048 |
57886..59442 |
D09_orf518 |
g1673763 |
D09_orf518 |
new, membrane export protein family see: MP334 |
  |
  |
  |
  |
MPN049, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 |
cc: 201..251; |
putative, see MP334 |
MP106 |
complement(146359..147915) |
| MPN049 |
59619..61517 |
D09_orf632 |
g1673761 |
D09_orf632 |
new, membrane export protein family see: MP334 |
  |
  |
  |
MG096 |
MPN048, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 |
sp: 1..28; cc: 317..372; |
putative, see MP334 |
MP105 |
complement(144284..146182) |
| MPN050 |
complement(61977..63503) |
glpK |
g1673760 |
D09_orf508 |
conf, glycerol kinase |
  |
1BU6-O |
Central intermediary metabolism, Other; glycerol kinase (glpK); glycerol + ATP = ADP + glycerol 3-phosphate; |
MG038 |
  |
  |
exp: 2D-Gel data from ZMBH Ges. |
MP104 |
142298..143824 |
| MPN051 |
complement(63494..64648) |
glpD |
g1673759 |
D09_orf384 |
less, glycerol-3-phospate dehydrogenase |
  |
1AA8-A |
Energy metabolism, Aerobic; aerobic glycerol-3-phospate dehydrogenase (GLPD); Sn-glycerol 3-phosphate+ NAD = glycerone phosphate + NADH ; |
MG039 |
  |
  |
less:glycerol-3-phospate dehydrogenase exp: 2D-Gel data from ZMBH Ges. |
MP103 |
141153..142307 |
| MPN052 |
64831..66804 |
D09_orf657 |
g1673758 |
D09_orf657 |
conf, putative lipoprotein, MG040 homolog, from M. genitalium |
  |
  |
  |
MG040 |
  |
sp: 1..20; lc: 258..270; |
exp: 2D-Gel data from ZMBH, TX-UF, Ges.; Gel96+258 ca. 8kD c-term. Stueck, Gel140+157 22kD Bruchst. aus Mitte, IEP ca. 9.8 |
MP102 |
complement(138997..140970) |
| MPN053 |
66822..67088 |
ptsH |
g1673757 |
D09_orf88 |
conf, phosphocarrier protein HPr |
  |
1PCH |
transporter, general PTS system component; |
MG041 |
  |
  |
N-term-seq MKKIGVVKD as predictes; expressed as protein; 2D-Gel data from ZMBH, Ges., Cytosol; |
MP101 |
complement(138713..138979) |
| MPN054 |
68627..68998 |
D09_orf123 |
g1673756 |
D09_orf123 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..22; |
less |
MP100 |
complement(136803..137174) |
| MPN055 |
70404..72086 |
potA |
g1673754 |
D09_orf560L |
conf, spermidine/putrescine transport ATP-binding prot |
  |
  |
Transporter, ABC superfamily; polyamine transport |
MG042 |
MPN134, MPN081, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
cc: 148..223; |
  |
MP099 |
complement(133715..135397) |
| MPN056 |
72088..72948 |
potB |
g1673753 |
D09_orf286b |
conf, spermidine/putrescine transport system permease |
  |
  |
Transporter, ABC superfamily; polyamine transport |
MG043 |
MPN057 |
sp: 1..32; tm: 64..84 93..113 138..158 193..213 248..268; lc: 114..126; |
  |
MP098 |
complement(132853..133713) |
| MPN057 |
72941..73801 |
potI |
g1673752 |
D09_orf286a |
conf, spermidine/putrescine transport system permease |
  |
  |
Transporter, ABC superfamily; polyamine transport |
MG044 |
MPN056, MPN637, MPN610 |
sp: 1..40; tm: 78..98 121..141 144..164 195..215 246..266; |
  |
MP097 |
complement(132000..132860) |
| MPN058 |
73786..75243 |
D09_orf485 |
g1673751 |
D09_orf485 |
conserved hypothetical |
  |
  |
  |
MG045 |
  |
sp: 1..23; lc: 391..415 423..439; |
less, unknown function; suggestion STRING-server: periplasmic binding, ABC transporter; |
MP096 |
complement(130558..132015) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN059 |
75243..76202 |
gcp |
g1673750 |
D09_orf319 |
conf, o-sialoglycoprotein endopeptidase |
  |
  |
  |
MG046 |
  |
  |
  |
MP095 |
complement(129599..130558) |
| MPN060 |
76186..77337 |
metX |
g1673749 |
D09_orf383 |
conf, S-adenosylmethionine synthetase 2 |
  |
1FUG-A |
  |
MG047 |
  |
  |
  |
MP094 |
complement(128464..129615) |
| MPN061 |
complement(77625..78977) |
ffh |
g1673748 |
D09_orf450 |
conf, signal recognition particle protein |
  |
1FFH |
  |
MG048 |
MPN425 |
  |
  |
MP093 |
126824..128176 |
| MPN062 |
79033..79749 |
deoD |
g1673747 |
D09_orf238 |
conf, purine-nucleoside phosphorylase |
  |
1A69-A |
Purines, pyrimidines, nucleosides and nucleotides, Salvage of nucleosides and nucleotides; purine-nucleoside phosphorylase; Purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate; in addition it can transfer ribose from one base to another base; note that MP089 - MP092 all could work together, operon like; |
MG049 |
  |
  |
exp: N-term-seq MTPHINAKKD as predicted; expressed as a protein; |
MP092 |
complement(126052..126768) |
| MPN063 |
79753..80427 |
deoC |
g1673746 |
D09_orf224 |
conf, deoxyribose-phosphate aldolase |
  |
  |
Energy metabolism, Sugars. deoxyribose-phosphate aldolase (deoC); 2-deoxy-D-ribose 5-phosphate = D-glyceraldehyde 3-phosphate + acetaldehyde; |
MG050 |
  |
  |
exp: 2D-Gel data from ZMBH, Ges., IEP 8.9; |
MP091 |
complement(125374..126048) |
| MPN064 |
80414..81679 |
deoA |
g1673745 |
D09_orf421 |
conf, thymidine phosphorylase |
  |
1TPT |
Purines, pyrimidines, nucleosides and nucleotides, purine ribonucleotide biosynthesis; thymidine phosphorylase; Thymidine + Phosphate = Thymin + deoxyribose 1-phosphate. |
MG051 |
  |
  |
  |
MP090 |
complement(124122..125387) |
| MPN065 |
81690..82091 |
cdd |
g1673744 |
D09_orf133 |
conf, cytidine deaminase |
  |
1AF2-A |
Purines, pyrimidines, nucleosides and nucleotides, purine ribonucleotide biosynthesis;cytidine deaminase; Cytidine + H2O = uracile + NH3. |
MG052 |
  |
  |
exp: 2D-Gel data from ZMBH, Ges. |
MP089 |
complement(123710..124111) |
| MPN066 |
82081..83745 |
cpsG |
g1673743 |
D09_orf554 |
less, two functions are possible, as both enzymes are homologous to each other: phosphomannomutase or phosphoglucomutase |
  |
1JDY-A |
Energy metabolism, Sugars; phosphomannomutase (cpsG); D-mannose 1-phosphate = D-mannose 6-phosphate; phosphoglucomutase; D-glucose 1-phosphate = D-glucose 6-phosphate; |
MG053 |
  |
  |
less; second enzyme is homolgous; looking at the pathway, the isolated mannose activity makes not too much sense; the phosphoglucomutase seems to fit better; |
MP088 |
complement(122056..123720) |
| MPN067 |
complement(83713..84675) |
nusG |
g1673742 |
D09_orf320 |
conf, transcription antitermination factor |
  |
  |
  |
MG054 |
  |
  |
exp: expressed as protein; N-term-seq MEQVELIPQT as predicted; |
MP087 |
121126..122088 |
| MPN068 |
complement(84683..85060) |
D09_orf125 |
g1673741 |
D09_orf125 |
new_conf, SecE |
  |
  |
  |
MG055 |
  |
tm: 91..111; |
new_conf Koonin COG; SecE Protein Transport system; -----qvcebrhujgpolinx [N] COG0690 Preprotein translocase subunit SecE |
MP086 |
120741..121118 |
| MPN069 |
complement(85066..85212) |
  |
New identified |
New identified |
ribosomal protein L33 |
  |
  |
  |
  |
  |
  |
  |
085-086 |
120589..120735 |
| MPN070 |
complement(85228..85611) |
D09_orf127a |
g1673739 |
D09_orf127a |
conf, D09_orf127a Protein |
  |
  |
  |
MG055.2 |
  |
sp: 1..27; tm: 56..76; |
  |
MP085 |
120190..120573 |
| MPN071 |
complement(85598..86428) |
yabC |
g1673738 |
D09_orf276 |
hypothetical protein (yabC) homolog; similar to Swiss-Prot Accession Number P37544, from B. subtilis |
  |
  |
  |
MG056 |
  |
  |
exp: RNA data from ZMBH, only at 32 degrees (twice), RNA-expressed; |
MP084 |
119373..120203 |
| MPN072 |
complement(86410..86946) |
yabF |
g1673737 |
D09_orf178 |
new_conf, similar to nucelotidyl transferase/polynicleotide cleavage |
  |
  |
  |
MG057 |
  |
1-100 Toprim domain; |
exp: RNA data from ZMBH, RNA-expressed; sequence annotation or this protein by Aravind in pubmed PMID: 9722641, UI: 98391745; new_conf koonin; |
MP083 |
118855..119391 |
| MPN073 |
complement(86925..88091) |
prs |
g1673736 |
D09_orf388 |
conf, phosphoribosylpyrophosphate synthetase |
  |
1OPR |
Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis; phosphoribosylpyrophosphate synthetase (prs); ATP + Ribose5Phosphate = PhosphoRibosylPyrroPhosphate + AMP. |
MG058 |
MPN033, MPN395 |
  |
Mikita noticed here an overlap of 194 nts with MP081; new_conf Bairoch swissprot P75044 considers that this protein starts in fact really at MGLITHNEFA, so later |
MP082 |
117710..118876 |
| MPN074 |
complement(87898..88341) |
D09_orf147 |
g1673735 |
D09_orf147 |
hypothetical protein (A43259) homolog; similar to GenBank Accession Number A43259, from E. hirae |
  |
  |
  |
MG059 |
  |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP081 |
117460..117903 |
| MPN075 |
88348..89247 |
ywdF |
g1673734 |
D09_orf299 |
new_conf, Glycosyl Transferase |
  |
  |
  |
MG060 |
MPN028 |
  |
new_conf pfam; Pfam:Glycos_transf_2 (4-170); exp: RNA data from ZMBH, RNA-expressed; |
MP080 |
complement(116554..117453) |
| MPN076 |
complement(89299..90993) |
uhpT |
g1673733 |
R02_orf564o |
HYPOTHETICAL PROTEIN |
  |
  |
  |
MG061 |
MPN077 |
sp: 1..25; tm: 87..107 168..188 221..241 249..269 306..326 361..381 391..411 415..435 455..475 503..523; |
less; HYPOTHETICAL PROTEIN; exp: RNA data from ZMBH, RNA-expressed; |
MP079 |
114808..116502 |
| MPN077 |
complement(91199..92839) |
R02_orf469 |
g1673732 |
R02_orf469 |
hypothetical, see: MP079 |
  |
  |
  |
  |
MPN076 |
sp: 1..28; tm: 110..130 143..163 171..191 224..244 267..287 300..320 323..343 362..382 403..423; lc: 55..72; |
  |
MP078 |
113193..114602 |
| Ser-tRNA(AGC) |
complement(93052..93140) |
mptgsb |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(93052..93140) |
112661..112749 |
| MPN078 |
93191..95275 |
fruA |
g1673731 |
R02_orf694 |
conf, fructose-permease IIBC component |
  |
1A6J-A |
transporter, PTS; for fructose; note just besides 1-phosphofructokinase MP076, MP077 generates fuctose 1-phosphate during transport; |
MG062 |
MPN651, MPN575 |
tm: 318..338 365..385 422..442 461..481 500..520 544..564 577..597 605..625 656..676; |
  |
MP077 |
complement(110526..112610) |
| MPN079 |
95268..96170 |
fruK |
g1673730 |
R02_orf300 |
conf, 1-phosphofructokinase |
  |
1RKD |
Energy metabolism, Glycolysis; 1-phosphofructokinase (fruK); fructose 1-phosphate + ATP = fructose 1,6-biphosphate; note that this immediately turns the fructose 1-phosphate generated by transport from MP067 into glycolysis; |
MG063 |
  |
lc: 162..171; |
exp: 2D-Gel data from ZMBH, Ges., ca. 36kD; |
MP076 |
complement(109631..110533) |
| MPN080 |
96407..100567 |
R02_orf1386V |
g1673728 |
R02_orf1386V |
new, Probably ABC transporter membrane protein subunit |
  |
  |
Transporter, ABC superfamily; probably membrane subunit for MP074; |
MG064 |
MPN684 |
sp: 1..31; tm: 517..537 561..581 606..626 682..702 1259..1279 1301..1321 1349..1369; lc: 286..303; |
blast finds at 0.0037 part of the ABC transporter membrane protein and we have the TM regions (see intrinsics), furthermore MP074 requires its other component one could tentatively suggest this. Q 505-597; S359-450; Streptococcus mutans ABC transporter; (higher 4 blast values only for hypothetical proteins); no COG,Koonin; no Sternberg (1.3.00); |
MP075 |
complement(105234..109394) |
| MPN081 |
100567..101964 |
glnQ |
g1673727 |
R02_orf465 |
conf, glutamine transport ATP-binding protein |
  |
  |
Transporter, ABC superfamily; transports glutamine, perhaps more aminoacids; |
MG065 |
MPN134, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
  |
  |
MP074 |
complement(103837..105234) |
| MPN082 |
101985..103931 |
tklB |
g1673726 |
R02_orf648 |
conf, transketolase 1 |
  |
1AY0-A |
Energy metabolism, Pentose Phosphate pathway; transketolase 1; Sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-ribose 5-phosphate + D-xylulose 5-phosphate note: Thiamin pyrophosphate cofactor Wide specificity for both reactants, e.g. converts hydroxypyruvate and R-CHO into CO(2) and R-CHOH-CO-CH(2)OH.Transketolase e.g.from Alcaligenes faecalis shows high activity with D-erythrose as acceptor. This enzyme could fill up several gaps in PPP. |
MG066 |
MPN393 |
lc: 545..559; |
exp: 2D-Gel data from ZMBH, Ges., |
MP073 |
complement(101870..103816) |
| MPN083 |
103941..105542 |
R02_orf533 |
g1673725 |
R02_orf533 |
only a conserved hypothetical,MG067 homolog, from M. genitalium |
  |
  |
  |
MG067 |
MPN084, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 |
sp: 1..24; |
less; HYPOTHETICAL PROTEIN, |
MP072 |
complement(100259..101860) |
| MPN084 |
105592..107166 |
R02_orf524 |
g1673724 |
R02_orf524 |
conserved hypothetical, see: MP072 |
  |
  |
  |
MG068 |
MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 |
sp: 1..22; |
  |
MP071 |
complement(98635..100209) |
| MPN085 |
107273..108595 |
R02_orf440 |
g1673723 |
R02_orf440 |
new, adhesin P1 (group2) homolog; see: MP025 |
  |
  |
  |
  |
MPN129, MPN090, MPN087, MPN086, MPN593 |
sp: 1..45; tm: 56..76 95..115 138..158 209..229 245..265 268..288 392..412; cc: 116..137; |
via homology to MP025 |
MP070 |
complement(97206..98528) |
| MPN086 |
108857..109174 |
R02_orf105 |
g1673722 |
R02_orf105 |
new, adhesin P1 (group2) homolog; see: MP025 |
  |
  |
  |
  |
MPN085, MPN435 |
sp: 1..45; tm: 64..84; |
via homology to MP070 |
MP069 |
complement(96627..96944) |
| MPN087 |
109346..109798 |
R02_orf150 |
g1673721 |
R02_orf150 |
new, adhesin P1 (group2) homolog; see: MP025 |
  |
  |
  |
  |
MPN085 |
tm: 43..63 85..105 124..144; |
via homology to MP070 |
MP068 |
complement(96003..96455) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN088 |
110813..111118 |
R02_orf101 |
g1673718 |
R02_orf101 |
conf, R02_orf101 Protein |
  |
  |
  |
  |
  |
  |
  |
MP067 |
complement(94683..94988) |
| MPN089 |
111610..112617 |
hsdS |
g1673717 |
R02_orf335 |
conf, see: MP335 |
  |
  |
  |
  |
MPN638, MPN615, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201 |
lc: 105..126; |
family, see main representative MP335 |
MP066 |
complement(93184..94191) |
| MPN090 |
112772..113761 |
R02_orf329 |
g1673716 |
R02_orf329 |
new, adhesin P1 (group2) homolog; see: MP025 |
  |
  |
  |
  |
MPN129, MPN085 |
sp: 1..43; tm: 78..98 163..183 218..238 265..285 299..319; lc: 193..209; |
via homology to MP025 |
MP065 |
complement(92040..93029) |
| MPN091 |
113838..114254 |
R02_orf138 |
g1673715 |
A05_orf139 |
conserved hypothetical,see: MP378 |
  |
  |
  |
  |
MPN115, MPN463 |
  |
  |
MP064 |
complement(91547..91963) |
| MPN092 |
114572..115093 |
R02_orf173 |
g1673714 |
R02_orf173 |
new_conf, involved in cytadherence,see: MP012 |
  |
  |
  |
  |
MPN149, MPN142, MPN102, MPN503, MPN464, MPN414, MPN367 |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP062 |
complement(90708..91229) |
| MPN093 |
114948..115853 |
R02_orf301 |
g1673713 |
R02_orf301 |
new_conf, involved in cytadherence, see: MP012 |
  |
  |
  |
  |
MPN150, MPN142, MPN102, MPN503, MPN464, MPN414, MPN367 |
lc: 49..62; |
exp: RNA data from ZMBH, RNA-expressed; |
MP061 |
complement(89948..90853) |
| MPN094 |
116287..116709 |
R02_orf140 |
g1673712 |
R02_orf140 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 116..139; |
URF; exp: RNA data from ZMBH, RNA-expressed; |
MP060 |
complement(89092..89514) |
| 16S_rRNA |
118312..119824 |
No info |
  |
  |
The region is selected according to Database of Small Subunit of rRNA and Genbank(acc:M29061). In the ssu DB, 3'-48 more residues to M29061 are expected by alignment of closely related species, so I extended the 48 residue to the region that is coverd by M29061. M29061 lacks 5'-TCA and 3'-56 residues comparing to ZMBH www page. There are 5 mismatchs between the selected region in the genome sequence and M29061 (4 out of 5 is 'N' in M29061). |
  |
  |
  |
  |
  |
  |
  |
118312..119824 |
complement(85977..87489) |
| 23S_rRNA |
120057..122961 |
No info |
  |
  |
The region is selected according to Database of Large Subunit of rRNA and Genbank(acc:X68422). X68422 lacks 5'-A but more 3'-179 residues comparing to ZMBH www page. |
  |
  |
  |
  |
  |
  |
  |
120057..122961 |
complement(82840..85744) |
| 5S_rRNA |
122999..123106 |
No info |
  |
  |
no 5S rRNA in Genbank. The region is selected according to the 5S rRNA DB (rose.man.poznan.pl/5SData). In ZMBH www page, 5'-TTTGG is missing. |
  |
  |
  |
  |
  |
  |
  |
122999..123106 |
complement(82695..82802) |
| MPN095 |
123290..124054 |
R02_orf254 |
g1673710 |
R02_orf254 |
new_conf, aa_permeases see: MP058 |
  |
  |
Transporters, probably APC family like; amino acid permease |
  |
MPN308 |
sp: 1..33; tm: 53..73 105..125 145..165 179..199 213..233; |
new_conf; Homology with Nterm of MP528 (aa_permeases) join MP059 MP058 = MP528 Pfam:aa_permeases (Evalue - 0.64) See aligment. Also confirmed by COG0531 |
MP059 |
complement(81747..82511) |
| MPN096 |
124054..124848 |
R02_orf264 |
g1673709 |
R02_orf264 |
new_conf, aa_permeases |
  |
  |
Transporters, probably APC family like; amino acid permease |
  |
MPN308 |
sp: 1..20; tm: 40..60 101..121 147..167 179..199 216..236; |
new_conf; Homology with Cterm of MP528 (aa_permeases) join MP059 MP058 = MP528 Pfam:aa_permeases (Evalue - 0.64) See aligment. Also confirmed by COG0531 |
MP058 |
complement(80953..81747) |
| MPN097 |
125024..126649 |
R02_orf541 |
g1673708 |
R02_orf541 |
conserved hypothetical see: MP631 |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 |
sp: 1..27; lc: 39..52 224..238 406..418 448..460; |
see comments to MP631. |
MP057 |
complement(79152..80777) |
| MPN098 |
126947..127390 |
R02_orf147 |
g1673707 |
R02_orf147 |
conserved hypothetical see: MP631 |
  |
  |
  |
  |
MPN152, MPN147, MPN506, MPN408, MPN364, MPN288, MPN284, MPN282, MPN200, MPN199 |
  |
see comments to MP631. |
MP056 |
complement(78411..78854) |
| MPN099 |
128076..129119 |
R02_orf347L |
g1673706 |
R02_orf347L |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN500, MPN409, MPN370, MPN286, MPN203, MPN202 |
lc: 189..209 306..327; |
  |
MP055 |
complement(76682..77725) |
| MPN100 |
129458..130009 |
R02_orf183o |
g1673705 |
R02_orf183o |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 116..142; |
exp: RNA data from ZMBH, RNA-expressed; |
MP054 |
complement(75792..76343) |
| MPN101 |
130466..131752 |
C09_orf428V |
g1673703 |
C09_orf428V |
conf, see: MP013 |
  |
  |
  |
  |
MPN141, MPN128, MPN502, MPN462, MPN370, MPN205 |
lc: 131..140 170..190 249..268 366..378; |
  |
MP053 |
complement(74049..75335) |
| MPN102 |
132568..133386 |
C09_orf272 |
g1673702 |
C09_orf272 |
new_conf, involved in cytadherence, see: MP012 |
  |
  |
  |
  |
MPN150, MPN149, MPN142, MPN093, MPN092, MPN503, MPN464, MPN414, MPN367 |
lc: 13..28; |
exp: RNA data from ZMBH, at 32 degrees, only once; RNA-expressed ? |
MP052 |
complement(72415..73233) |
| MPN103 |
complement(134055..134573) |
C09_orf172 |
g1673701 |
C09_orf172 |
conf, C09_orf172 Protein |
  |
  |
  |
  |
MPN037, MPN465 |
tm: 26..46; |
  |
MP051 |
71228..71746 |
| MPN104 |
134583..134897 |
C09_orf104 |
g1673700 |
C09_orf104 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF; exp: RNA data from ZMBH, high at 32 and 37, RNA-expressed; |
MP050 |
complement(70904..71218) |
| MPN105 |
135731..136756 |
pheS |
g1673699 |
C09_orf341 |
conf, phenylalanyl-tRNA synthetase alpha-subunit |
  |
1PYS-A, 1PYS-B, 1ASY-A |
  |
MG194 |
  |
  |
  |
MP049 |
complement(69045..70070) |
| MPN106 |
136759..139176 |
pheT |
g1673698 |
C09_orf805 |
conf, phenylalanyl-tRNA synthetase beta chain |
  |
1PYS-B |
  |
MG195 |
MPN663 |
  |
  |
MP048 |
complement(66625..69042) |
| MPN107 |
139289..140044 |
C09_orf251 |
g1673697 |
C09_orf251 |
conserved hypothetical protein |
  |
  |
  |
  |
  |
lc: 186..196; |
Lactococcus lactis Region new_add; similarity Lactococcus lactis(sptrembl:O53069) Funtional annotation of Lactococcus lactis proteins is probably wrong; exp: RNA data from ZMBH, 32 degrees (twice), RNA-expressed; |
MP047 |
complement(65757..66512) |
| MPN108 |
140046..141260 |
C09_orf404 |
g1673696 |
C09_orf404 |
conserved hypothetical, see: MP043 |
  |
  |
  |
  |
MPN111 |
lc: 262..276; |
Lactococcus lactis Region new_add; similarity C-ter (843-1268) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. |
MP046 |
complement(64541..65755) |
| MPN109 |
141940..142437 |
C09_orf165 |
g1673694 |
C09_orf165 |
conf, C09_orf165 Protein |
  |
  |
  |
  |
  |
cc: 71..98; |
2d-Gel-PH Ges. |
MP045 |
complement(63364..63861) |
| MPN110 |
142361..144517 |
C09_orf718 |
g1673693 |
C09_orf718 |
conserved hypothetical protein |
  |
  |
  |
  |
  |
lc: 581..598; |
Lactococcus lactis Region new_add; similarity N-ter (293-701) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. exp: RNA data from ZMBH, both at 32 and 37 degrees; RNA-expressed |
MP044 |
complement(61284..63440) |
| MPN111 |
145021..146289 |
C09_orf422 |
g1673692 |
C09_orf422 |
conserved hypothetical protein |
  |
  |
  |
  |
MPN108 |
  |
Lactococcus lactis Region new_add; similarity C-ter (843-1268) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. exp: RNA data from ZMBH, but only once at 32 degree seen with low expression (below 150 not sure above background): Really doubtful / URF |
MP043 |
complement(59512..60780) |
| MPN112 |
147149..147541 |
C09_orf130b |
g1673691 |
C09_orf130b |
new_conf, permease |
  |
  |
  |
  |
MPN421 |
tm: 32..52 71..91 101..121; |
via homology to MP420; also COG0477; |
MP042 |
complement(58260..58652) |
| MPN113 |
148090..148761 |
C09_orf223 |
g1673690 |
C09_orf223 |
new, Similarity to G3P transporters |
  |
  |
  |
  |
MPN421 |
tm: 28..48 60..80 91..111 174..194; |
new; Join MP42 MP41 Similarity with G3P transporters |
MP041 |
complement(57040..57711) |
| MPN114 |
148751..150553 |
cpt2 |
g1673689 |
C09_orf600 |
more__, Acyltransferase |
  |
  |
Fatty acid and phospholipid metabolism; carnitine acyltransferase; acylCoA + carnitin = CoA + acylcarnitine; transporter, membrane carrier; |
  |
  |
lc: 129..141; |
new_add; Horizontal Transfer less; Acyltransferase Probably Carnitine dependent |
MP040 |
complement(55248..57050) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN115 |
150643..151248 |
infC |
g1673688 |
C09_orf201 |
conf, translation initiation factor IF3 |
  |
2IFE, 1TIF |
  |
MG196 |
  |
  |
  |
MP039 |
complement(54553..55158) |
| MPN116 |
151254..151433 |
rpmI |
g1673687 |
C09_orf59 |
conf, ribosomal protein L35 |
  |
  |
  |
MG197 |
  |
  |
SUB; SUB ribosomal; annot full length true (psi-blast); |
MP038 |
complement(54368..54547) |
| MPN117 |
151444..151827 |
rpLT |
g1673686 |
C09_orf127 |
conf, ribosomal protein L20 |
  |
  |
  |
MG198 |
  |
  |
SUB; |
MP037 |
complement(53974..54357) |
| MPN118 |
complement(151802..152512) |
C09_orf143b |
g1673685 |
C09_orf143b |
new_conf, Similarity with Ribonuclease HII |
  |
  |
  |
MG199 |
  |
lc: 71..84; |
new_conf; Dr.M.Itaya Similarity with Ribonuclease HII; to be more exact, with rnhC from B.subtilis (J.Bacteriol 181, 2118-2123; in psi-blast one finds only that it is an RNAseH II / rnhB, but the direct investigation in B.sub indicates more rnhC as far as B.sub co9ncerned; essential gene; Mikitas extension gives a much more sensible weight of 23.6 kDa; B.sub has 33.9; RNA data from ZMBH, exp: the gene is well expressed. Question: Is there confirmatory size estimate by Northern available (or even by two different oligos to show that N-terminal extension IS expressed) ? (N-terminal sequencing is even better); Bairoch: protein starts at the old start P75446 swissnew |
MP036 |
53568..53999 |
| MPN119 |
152568..155300 |
C09_orf910 |
g1673683 |
C09_orf910 |
less, contains j-domain of DnaJ; and a domain common to cytadherence proteins |
1-77 similar to j-domain of DnaJ; 233-259 domain present only in MP/MG |
1HDJ |
cochaperon (?) possible activation of DnaK |
MG200 |
MPN021, MPN002, MPN567, MPN447, MPN391 |
lc: 109..120 268..284; |
unconnected; contains a domain repeated in DNJM/P200/HMV1 of both MP/MG (cytadherence related proteins); story: possible link between cell surface and chaperon activity; not a DnaJ but likely to activate DnaK as it contains a j-domain of DnaJ; exp: 94149015 _ECOLI |
MP035 |
complement(50501..53233) |
| MPN120 |
155323..155976 |
grpE |
g1673682 |
C09_orf217 |
conf, heat shock protein GrpE |
  |
1DKG-A |
chaperon |
MG201 |
  |
cc: 23..104; |
sub:hsp70 with DnaJ, MP133 and DnaK MP407 2D-Gel data from ZMBH, Ges., IEP 8.2 |
MP034 |
complement(49825..50478) |
| MPN121 |
155976..156341 |
C09_orf121 |
g1673681 |
C09_orf121 |
conserved hypothetical |
  |
  |
  |
MG202 |
  |
  |
Only hits MG; |
MP033 |
complement(49460..49825) |
| Thr-tRNA(ACC) |
complement(156359..156432) |
mptgt |
  |
  |
in Genbank, [tRNA] /note="codon recognized: GGT" and [gene] /note="Thr-tRNA(GGU) gene" are wrong. |
  |
  |
  |
  |
  |
  |
  |
complement(156359..156432) |
49369..49442 |
| MPN122 |
156467..158374 |
parB |
g1673680 |
C09_orf635 |
conf, topoisomerase IV subunit B |
  |
1BGW, 1AJ6 |
  |
MG203 |
MPN003 |
lc: 458..471; |
sub; B TOPOISOMERASE IV |
MP032 |
complement(47427..49334) |
| MPN123 |
158374..160743 |
parC |
g1673679 |
C09_orf789 |
conf, topoisomerase IV subunit A |
  |
1AB4 |
  |
MG204 |
MPN004 |
cc: 432..463; lc: 289..303; |
sub; A TOPOISOMERASE IV |
MP031 |
complement(45058..47427) |
| MPN124 |
complement(160730..161785) |
yqxE |
g1673678 |
C09_orf351 |
conf, protein (hrcA) homolog; similar to Swiss-Prot Accession Number P25499, from B. subtilis |
  |
  |
cell control |
MG205 |
  |
cc: 317..343; |
represses expression of Dnak and GroE operons |
MP030 |
44016..45071 |
| MPN125 |
161817..163577 |
uvrC |
g1673677 |
C09_orf586L |
conf, excinuclease ABC subunit C |
  |
  |
  |
MG206 |
  |
lc: 317..330; |
sub; Subunit C EXCINUCLEASE ABC |
MP029 |
complement(42224..43984) |
| MPN126 |
163613..164092 |
C09_orf159 |
g1673676 |
C09_orf159 |
conf, MG207 homolog, from M. genitalium |
  |
  |
  |
MG207 |
  |
  |
2D-Gel data from ZMBH |
MP028 |
complement(41709..42188) |
| MPN127 |
164484..165026 |
C09_orf180 |
g1673675 |
C09_orf180 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF but exp: RNA data from ZMBH, RNA-expressed; |
MP027 |
complement(40775..41317) |
| MPN128 |
166483..166932 |
C09_orf149a |
g1673674 |
C09_orf149a |
conf, see: MP013 |
  |
  |
  |
  |
MPN141, MPN101, MPN502, MPN462, MPN205 |
lc: 26..45; |
  |
MP026 |
complement(38869..39318) |
| MPN129 |
167632..168081 |
C09_orf149b |
g1673673 |
C09_orf149b |
conf, adhesin P1 (group 2) homolog; similar to GenBank Accession Number A41480, from M. pneumoniae |
  |
  |
  |
  |
MPN090, MPN085 |
tm: 41..61 88..108 113..133; |
  |
MP025 |
complement(37720..38169) |
| MPN130 |
169042..169464 |
C09_orf140o |
g1673672 |
C09_orf140o |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 97..139; |
URF but exp: RNA data from ZMBH, RNA-expressed; |
MP024 |
complement(36337..36759) |
| MPN131 |
170068..170733 |
E07_orf221V |
g1673670 |
E07_orf221V |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN500, MPN468, MPN409, MPN370, MPN286, MPN202 |
lc: 20..36 111..126 184..199; |
  |
MP023 |
complement(35068..35733) |
| MPN132 |
171049..171819 |
E07_orf256L |
g1673669 |
E07_orf256L |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN099, MPN500, MPN409, MPN370, MPN286, MPN203, MPN202 |
lc: 53..75 126..137 155..167 170..186; |
  |
MP022 |
complement(33982..34752) |
| MPN133 |
172277..173182 |
E07_orf301 |
g1673668 |
E07_orf301 |
conf, putative lipoprotein, MG186 homolog, from M. genitalium |
  |
  |
  |
MG186 |
  |
sp: 1..26; cc: 62..94; lc: 227..240; |
  |
MP021 |
complement(32619..33524) |
| MPN134 |
173206..174966 |
ugpC |
g1673667 |
E07_orf586 |
conf, sn-glycerol-3-phosphate transport system permease protein |
  |
  |
Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit; |
MG187 |
MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
cc: 229..254 320..346; |
add: 123-336 insertion of charge residues, 2D-Gel data from ZMBH Ges. |
MP020 |
complement(30835..32595) |
| MPN135 |
174959..175948 |
ugpA |
g1673666 |
E07_orf329 |
conf, sn-glycerol-3-phosphate transport system permease protein |
  |
  |
Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit; |
MG188 |
MPN136 |
tm: 32..52 97..117 127..147 232..252 283..303; |
  |
MP019 |
complement(29853..30842) |
| MPN136 |
175920..176879 |
ugpE |
g1673665 |
E07_orf319 |
conf, sn-glycerol-3-phosphate transport system permease protein |
  |
  |
Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit; |
MG189 |
MPN135 |
tm: 41..61 103..123 134..154 169..189 230..250 283..303; |
  |
MP018 |
complement(28922..29881) |
| MPN137 |
complement(177457..178143) |
E07_orf228 |
g1673664 |
E07_orf228 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 113..222; |
URF but exp: RNA data from ZMBH, RNA-expressed; |
MP017 |
27658..28344 |
| MPN138 |
complement(178392..178892) |
E07_orf166 |
g1673663 |
E07_orf166 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 69..149; |
URF but exp: RNA data from ZMBH, RNA-expressed; |
MP016 |
26909..27409 |
| MPN139 |
complement(179129..179620) |
E07_orf163 |
g1673662 |
E07_orf163 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 76..103; |
URF but exp: RNA data from ZMBH, RNA-expressed; |
MP015 |
26181..26672 |
| MPN140 |
179871..180845 |
orf4 |
g1673660 |
E07_orf324 |
new_conf, DHH family phosphoesterases |
  |
  |
  |
MG190 |
MPN549 |
  |
new_conf;(17-320)Pfam:PF01368 DHH family Evalue 1e-05 exp;Trends Biochem Sci 23: 17-19 (1998)[PMID9478130,MUID98138617] A novel family of predicted phosphoesterases includes Drosophila prune protein and bacterial RecJ exonuclease. L. Aravind & E. V. Koonin; exp: RNA data from ZMBH, RNA-expressed; The phosphoesterase should functinally aid the attachment -> could have pharmacological implications. P1 cytadherence operon; |
MP014 |
complement(24956..25930) |
| MPN141 |
180858..185741 |
P1 |
g1673659 |
E07_orf1627 |
conf, ADP1_MYCPN adhesin P1 |
  |
  |
  |
MG191 |
MPN144, MPN142, MPN132, MPN131, MPN128, MPN101, MPN099, MPN502, MPN500, MPN468, MPN462, MPN453, MPN409, MPN370, MPN286, MPN205, MPN203, MPN202 |
sp: 1..27; tm: 530..550 1105..1125 1527..1547; lc: 261..280 337..350 832..849 963..975 1225..1237 1298..1326; |
2D-Gel data from ZMBH, Ges., ca. 80 kD, IEP ca. 7.3 former expression study; P1 cytadherence operon; |
MP013 |
complement(20060..24943) |
| MPN142 |
185747..189403 |
orf6 |
g1673658 |
E07_orf1218 |
new_conf, involved in cytadherence |
  |
  |
  |
MG192 |
MPN150, MPN149, MPN141, MPN102, MPN093, MPN092, MPN503, MPN464, MPN414, MPN367, MPN366 |
sp: 1..23; tm: 1123..1143; lc: 116..132 297..324 538..551; |
exp: RNA data from ZMBH, former expression result, 2D-Gel data from ZMBH, N-term 40kD Fragment, IEP ca. 10.1, RNA-expressed; orf6 of P1 cytadherence operon, the 130kD precursor, this splits into 40kD(B) and 90kDa(C), cytadherence associated, exact molecular function unknown; Note that MP012-MP014 probably form an operon as suggested (not more) by RBS and termination site for polycistronic messenger (Gene 82, 259-267; Inamine et al.,1989; UI: 90060815 ) ; however a point mutation in the P1 gene is accompanied by the loss of B and C (Krause,D. Mol Microbiol 20,247-253; 1996). With the experimental data and the literature this protein is no longer hypothetical. |
MP012 |
complement(16398..20054) |
| MPN143 |
189520..190047 |
E07_orf175 |
g1673657 |
E07_orf175 |
hypothetical |
  |
  |
  |
  |
  |
  |
Hits nothing, URF?; |
MP011 |
complement(15754..16281) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN144 |
190621..191862 |
E07_orf413 |
g1673656 |
E07_orf413 |
conf, see: MP013 |
  |
  |
  |
  |
MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN286, MPN203, MPN202 |
lc: 43..55 264..284 303..318 375..401; |
  |
MP010 |
complement(13939..15180) |
| MPN145 |
192214..192753 |
E07_orf179 |
g1673655 |
E07_orf179 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 152..178; lc: 58..71; |
URF, but exp: RNA data from ZMBH, RNA-expressed; |
MP009 |
complement(13048..13587) |
| MPN146 |
193071..193868 |
E07_orf265 |
g1673654 |
E07_orf265 |
conserved hypothetical, see: MP631 |
  |
  |
  |
  |
MPN152, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN281, MPN200, MPN199 |
  |
see comments to MP631. |
MP008 |
complement(11933..12730) |
| MPN147 |
193875..195332 |
E07_orf485 |
g1673653 |
E07_orf485 |
conserved hypothetical, see: MP631 |
  |
  |
  |
  |
MPN152, MPN098, MPN097, MPN506, MPN408, MPN364, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 |
lc: 155..174; |
see comments to MP631. |
MP007 |
complement(10469..11926) |
| MPN148 |
195875..196297 |
E07_orf140 |
g1673652 |
E07_orf140 |
conserved hypothetical, see: MP199 |
  |
  |
  |
  |
MPN012, MPN011, MPN649, MPN505, MPN466, MPN411, MPN369, MPN271 |
  |
  |
MP006 |
complement(9504..9926) |
| MPN149 |
196850..198154 |
E07_orf434 |
g1673650 |
E07_orf434 |
new_conf, see: MP012 |
  |
  |
  |
  |
MPN142, MPN102, MPN092, MPN503, MPN464, MPN414, MPN367, MPN366 |
lc: 70..86; |
but exp: RNA data from ZMBH, RNA-expressed; |
MP005 |
complement(7647..8951) |
| MPN150 |
197982..198656 |
E07_orf224 |
g1673649 |
E07_orf224 |
new_conf, see: MP012 |
  |
  |
  |
  |
MPN142, MPN102, MPN093, MPN503, MPN464, MPN414, MPN367 |
  |
but exp: RNA data from ZMBH, RNA-expressed; |
MP004 |
complement(7145..7819) |
| MPN151 |
199139..199540 |
E07_orf133 |
g1673648 |
E07_orf133 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF; but exp: RNA data from ZMBH, RNA-expressed; |
MP003 |
complement(6261..6662) |
| MPN152 |
199823..202207 |
E07_orf794 |
g1673647 |
E07_orf794 |
conserved hypothetical, see: MP631 |
  |
  |
  |
  |
MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 |
sp: 1..27; lc: 39..52 229..244 472..501; |
less, see comments to MP631. 2D-Gel data from ZMBH, 17kD, Ges., IEP ca. 10 ? |
MP002 |
complement(3594..5978) |
| MPN153 |
202383..205724 |
E07_orf1113 |
g1673646 |
E07_orf1113 |
conserved hypothetical, MG140 homolog, from M. genitalium |
  |
  |
  |
MG140 |
  |
lc: 958..970 1003..1016; |
  |
MP001 |
complement(77..3418) |
| Leu-tRNA(TTG) |
205801..648993 |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
205801..648993 |
complement(373202-373283) |
| MPN154 |
205801..207423 |
nusA |
g1674384 |
E07_orf540o |
conf, N-utilization substance protein A homolog; similar to Swiss-Prot Accession Number P32727, from B. subtilis |
  |
  |
  |
MG141 |
MPN452, MPN447, MPN167 |
lc: 67..83 453..504; |
Significant similarity to nusA from other bacterias. Other nusA is -500 aa and similar region between MP677 and others is from N-terminal to 370 aa. Rest of the segment have no similarity, except for MG. |
MP677 |
complement(814772..816394) |
| MPN155 |
207704..209557 |
infB |
g1674382 |
VXpSPT7_orf617 |
conf, protein synthesis initiation factor 2 |
  |
1EFU |
  |
MG142 |
MPN665, MPN475, MPN279, MPN227 |
cc: 386..418; |
sub translation initiation afctor; Only MP and MG have much shorter sequences. Others have 100-300 more residues at their N-terminal. One of the three factors required for the initiation of protein biosynthesis in bacteria. Other factors are: IF-1 (infA) (MP644) and IF-3 (infC) (MP039). |
MP676 |
complement(812638..814491) |
| MPN156 |
209560..209910 |
rbfA |
g1674381 |
VXpSPT7_orf116 |
conf, ribosome binding factor A |
  |
  |
  |
MG143 |
  |
  |
SUB; |
MP675 |
complement(812285..812635) |
| MPN157 |
209926..211134 |
VXpSPT7_orf402 |
g1674380 |
VXpSPT7_orf402 |
conserved hypothetical |
  |
  |
  |
MG144 |
MPN452 |
tm: 279..299 328..348 359..379; lc: 49..72 114..151 161..184; |
No homologs other than MG144, which has 279 aa and match C-terminal part of MP674. N-termianl 120 aa of MP674 has no homology. exp: RNA data from ZMBH, RNA-expressed; |
MP674 |
complement(811061..812269) |
| MPN158 |
211147..211956 |
yaaC |
g1674379 |
VXpSPT7_orf269 |
conf, riboflavin kinase (EC 2.7.1.26) (flavokinase) / FMN adenylyltransferase (EC 2.7.7.2) (FAD pyrophosphorylase) (FAD synthetase); bifunctional |
  |
  |
(EC 2.7.1.26) ATP + riboflavin = ADP + FMN; (EC 2.7.7.2) ATP + FMN = diphosphate + FAD. hypothesis: Can do in fact also ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD(+) EC 2.7.7.18 |
MG145 |
  |
  |
conf, because the description in P22990 means exactly that;SwissProt (P75587, RIBF_MYCPN) and Koonin's annotation to MG145 already assigned this double function, too. exp: _CORAM UI: 98322073; Though this is a bifunctional enzyme, the two reactions occur at a single active site. Bold hypothesis (has to be checked by experiment): reaction EC 2.7.7.18 for NAD synthesis pathway (see MP107, MP280) is also possible by this enzyme. exp: RNA data from ZMBH, RNA-expressed; |
MP673 |
complement(810239..811048) |
| MPN159 |
211982..213256 |
hlyC |
g1674378 |
VXpSPT7_orf424 |
wrong_, tlyC homolog, hemolysin activity doubtful, see comments |
  |
  |
  |
MG146 |
  |
sp: 1..29; tm: 67..87 100..120 134..154; |
wrong: not hlyC homolog but tlyC homolog; 1-29, signal peptide; 67-87, TM; 100-120, TM; 134-154, TM; 215-264, CBS (e=3.6e-4); 278-326, CBS (e=0.11); This entry has significant similarity to 'hypothetical' and 'hemolysin homolog' proteins. But no similarity to hemolysins (hlyC) from gram-negative bacterias. exp: _TREHY UI: 95058097; So far, only one paper about hemolytic activity of tlyC from Serpulina hyodysenteriae: MICROB. PATHOG. 16:269-82 (1994). This sequence is shorter (268 aa) than MP, and corresponds to 150-350 of MP. |
MP672 |
complement(808939..810213) |
| MPN160 |
213243..214376 |
VXpSPT7_orf377 |
g1674377 |
VXpSPT7_orf377 |
conserved hypothetical |
  |
  |
  |
MG147 |
  |
sp: 1..37; tm: 66..86 160..180 205..225 293..313 335..355; |
No homologs other than MG147. 1-37, signal peptide; 66-86, TM; 160-180, TM; 205-225, TM; 293-313, TM; 335-355, TM exp: RNA data from ZMBH, RNA-expressed; |
MP671 |
complement(807819..808952) |
| MPN161 |
214530..215867 |
VXpSPT7_orf445 |
g1674376 |
VXpSPT7_orf445 |
conserved hypothetical |
  |
  |
  |
MG148 |
  |
cc: 85..192 411..437; lc: 47..61; |
No homologs other than MG148. 85-192, CC; 411-438, CC. exp: RNA data from ZMBH, 32 degrees once, but clear, RNA-expressed; exp-PH: XDVKYLQVE N-term as predicted; could be expressed in Hep C8; |
MP670 |
complement(806328..807665) |
| MPN162 |
215989..216951 |
VXpSPT7_orf320 |
g1674375 |
VXpSPT7_orf320 |
conserved hypothetical |
  |
  |
  |
MG149 |
  |
sp: 1..25; lc: 62..82 86..98 171..186 206..258; |
No homologs other than MG149. 1-25, signal peptide. Characteristics of lipoproteins, i.e., (i) one or more basic residues near N-terminal, (ii) signal peptide, and (iii) a Cys residue downstream of the signal peptide, can be seen both of the MP and MG sequences. |
MP669 |
complement(805244..806206) |
| MPN163 |
217198..217536 |
VXpSPT7_orf112 |
g1674374 |
VXpSPT7_orf112 |
conserved hypothetical |
  |
  |
  |
MG149.1 |
  |
sp: 1..33; tm: 38..58; lc: 79..91; |
1-33, Signal peptide; 38-58, TM. PSI-Blast detects nothing other than MG149.1. |
MP668 |
complement(804659..804997) |
| MPN164 |
217630..217956 |
rpsJ |
g1674372 |
VXpSPT7_orf108 |
conf, ribosomal protein S10 |
  |
  |
  |
MG150 |
  |
lc: 29..44; |
SUB; |
MP667 |
complement(804239..804565) |
| MPN165 |
217970..218833 |
rplC |
g1674371 |
VXpSPT7_orf287 |
conf, ribosomal protein L3 |
  |
  |
  |
MG151 |
  |
lc: 228..252; |
SUB; MP sequence is much longer than others. MG lacks C-terminal 30 residues, and others lack C-terminal 50-70 residues comparing to MP. |
MP666 |
complement(803362..804225) |
| MPN166 |
218833..219471 |
rplD |
g1674370 |
VXpSPT7_orf212 |
conf, ribosomal protein L4 |
  |
  |
  |
MG152 |
  |
lc: 156..168; |
SUB; |
MP665 |
complement(802724..803362) |
| MPN167 |
219474..220187 |
rplW |
g1674369 |
VXpSPT7_orf237 |
conf, ribosomal protein L23 |
  |
  |
  |
MG153; MG219 |
  |
lc: 152..198; |
SUB; L23 proteins have about 100 residues. Only MP sequence has much longer C-terminal 130 residues. This segment was subjected to homology search (PSI-Blast), but there is no significant homolog. This segment is rich in K, E, A, V, and T. In the segment, 82.5% of the residues are either one of the five amino acids. |
MP664 |
complement(802008..802721) |
| MPN168 |
220187..221050 |
rplB |
g1674368 |
VXpSPT7_orf287 |
conf, ribosomal protein L2 |
  |
  |
  |
MG154 |
  |
  |
SUB; |
MP663 |
complement(801145..802008) |
| MPN169 |
221050..221313 |
rpS19 |
g1674367 |
VXpSPT7_orf87 |
conf, ribosomal protein S19 |
  |
  |
  |
MG155 |
  |
  |
SUB; |
MP662 |
complement(800882..801145) |
| MPN170 |
221240..221794 |
VXpSPT7_orf184 |
g1674366 |
VXpSPT7_orf184 |
conf, ribosomal protein L22 |
  |
1BXE |
  |
MG156 |
  |
  |
SUB; Only MP and MG have much longer N- and C-terminal residues (N-terminal 20-25 residues; C-terminal 30-50 residues). SwissProt assigns 26-Met as the first residue for both MP and MG. Bairoch: This starts at MIAFAK... (so 25 aa shorter at N-term). Mikita sees only 1bp intergenic region and that MP661/662 have 74 nts overlap. |
MP661 |
complement(800401..800955) |
| MPN171 |
221796..222617 |
rpsC |
g1674365 |
VXpSPT7_orf273 |
conf, ribosomal protein S3 |
  |
  |
  |
MG157 |
  |
lc: 85..96 225..238; |
SUB; Only MP and MG have much longer C-terminal sequences (40-50 residues). |
MP660 |
complement(799578..800399) |
| MPN172 |
222617..223036 |
rplP |
g1674364 |
VXpSPT7_orf139 |
conf, ribosomal protein L16 |
  |
  |
  |
MG158 |
  |
  |
SUB; |
MP659 |
complement(799159..799578) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN173 |
223036..223371 |
rpmC |
g1674363 |
GT9_orf111b |
conf, ribosomal protein L29 |
  |
  |
  |
MG159 |
  |
lc: 47..59; |
SUB; |
MP658 |
complement(798824..799159) |
| MPN174 |
223371..223628 |
rpsQ |
g1674362 |
GT9_orf85 |
conf, ribosomal protein S17 |
  |
1RIP |
  |
MG160 |
  |
  |
SUB; |
MP657 |
complement(798567..798824) |
| MPN175 |
223632..224000 |
rplN |
g1674361 |
GT9_orf122 |
conf, ribosomal protein L14 |
  |
1WHI |
  |
MG161 |
  |
  |
SUB; |
MP656 |
complement(798195..798563) |
| MPN176 |
224000..224335 |
rplX |
g1674360 |
GT9_orf111a |
conf, ribosomal protein L24 |
  |
  |
  |
MG162 |
  |
  |
SUB; |
MP655 |
complement(797860..798195) |
| MPN177 |
224338..224880 |
rplE |
g1674359 |
GT9_orf180b |
conf, ribosomal protein L5 |
  |
  |
  |
MG163 |
  |
lc: 166..177; |
SUB; |
MP654 |
complement(797315..797857) |
| MPN178 |
224882..225067 |
rpsN |
g1674358 |
GT9_orf61 |
conf, ribosomal protein S14 |
  |
  |
  |
MG164 |
  |
  |
SUB; |
MP653 |
complement(797128..797313) |
| MPN179 |
225061..225489 |
rpsH |
g1674357 |
GT9_orf142 |
conf, ribosomal protein S8 |
  |
1AN7-A |
  |
MG165 |
  |
  |
SUB; Only MP and MG have much longer N-terminal sequences (10 residues). |
MP652 |
complement(796706..797134) |
| MPN180 |
225496..226050 |
rplF |
g1674356 |
GT9_orf184 |
conf, ribosomal protein L6 |
  |
  |
  |
MG166 |
  |
  |
SUB; |
MP651 |
complement(796145..796699) |
| MPN181 |
226051..226401 |
rplR |
g1674355 |
GT9_orf116b |
conf, ribosomal protein L18 |
  |
  |
  |
MG167 |
  |
lc: 52..63; |
SUB; |
MP650 |
complement(795794..796144) |
| MPN182 |
226405..227064 |
rpsE |
g1674354 |
GT9_orf219 |
conf, ribosomal protein S5 |
  |
1PKP |
  |
MG168 |
  |
lc: 157..174; |
SUB; Only MP and MG have much longer N-terminal sequences (50-60 residues). |
MP649 |
complement(795131..795790) |
| MPN183 |
227068..227523 |
rplO |
g1674353 |
GT9_orf151 |
conf, ribosomal protein L15 |
  |
  |
  |
MG169 |
  |
  |
SUB; |
MP648 |
complement(794672..795127) |
| MPN184 |
227523..228956 |
secY |
g1674352 |
GT9_orf477 |
conf, preprotein translocase subunit SecY |
83-433, secY (Pfam) |
  |
  |
MG170 |
MPN080 |
sp: 1..46; tm: 82..102 129..149 165..185 211..231 234..254 286..306 327..347 387..407 412..432; lc: 67..81; |
sub protein export; One of the components for protein export. Other components are: secA (MP621) and secE (MP086?). |
MP647 |
complement(793239..794672) |
| MPN185 |
228950..229597 |
adk |
g1674351 |
GT9_orf215 |
conf, adenylate kinase |
  |
3ADK |
Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis(EC 2.7.4.3); adenylate kinase ATP + AMP = ADP + ADP; note: works also with other NTP. |
MG171 |
  |
  |
  |
MP646 |
complement(792598..793245) |
| MPN186 |
229597..230343 |
map |
g1674350 |
GT9_orf248 |
conf, methionine amino peptidase |
  |
1CHM-A |
(EC 3.4.11.18) L-methionylpeptide + H2O = L-methionine + peptide |
MG172 |
  |
  |
  |
MP645 |
complement(791852..792598) |
| MPN187 |
230343..230579 |
infA |
g1674349 |
GT9_orf78 |
conf, initiation factor 1 |
  |
1AH9 |
  |
MG173 |
  |
  |
sub translation initiation factor; One of the three factors required for the initiation of protein biosynthesis in bacteria. Other factors are: IF-2 (infB) (MP676) and IF-3 (infC) (MP039). |
MP644 |
complement(791616..791852) |
| MPN188 |
230590..230703 |
rpmJ |
g1674348 |
GT9_orf37 |
conf, ribosomal protein L36 |
  |
  |
  |
MG174 |
  |
  |
SUB; |
MP643 |
complement(791492..791605) |
| MPN189 |
230703..231077 |
rpsM |
g1674347 |
GT9_orf124b |
conf, ribosomal protein S13 |
  |
  |
  |
MG175 |
  |
  |
SUB; |
MP642 |
complement(791118..791492) |
| MPN190 |
231077..231442 |
rpsK |
g1674346 |
GT9_orf121 |
conf, ribosomal protein S11 |
  |
  |
  |
MG176 |
  |
  |
SUB; |
MP641 |
complement(790753..791118) |
| MPN191 |
231448..232431 |
rpoA |
g1674345 |
GT9_orf327 |
conf, RNA polymerase alpha core subunit |
  |
1COO |
  |
MG177 |
  |
  |
sub RNA polymerase |
MP640 |
complement(789764..790747) |
| MPN192 |
232434..232808 |
rplQ |
g1674344 |
GT9_orf124a |
conf, ribosomal protein L17 |
17-119, Ribosomal_L17 (Pfam) |
  |
  |
MG178 |
  |
  |
SUB; |
MP639 |
complement(789387..789761) |
| MPN193 |
232792..233616 |
cysA |
g1674343 |
GT9_orf274 |
less, cobalt transport ATP-binding protein |
35-217, ABC_tran (Pfam) |
  |
Transporter, ABC superfamily; cobalt transporter subunit; |
MG179 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN571, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194 |
  |
less: this sequence is higher similar to cobalt transporter than sulfate transporter; sub ABC transporter |
MP638 |
complement(788579..789403) |
| MPN194 |
233604..234515 |
hisP |
g1674342 |
GT9_orf303 |
less, cobalt transport ATP-binding protein |
47-236, ABC_tran (Pfam) |
  |
Transporter, ABC superfamily; cobalt transporter subunit; |
MG180 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN193 |
  |
less: this sequence is higher similar to cobalt transporter than histidine transporter; sub ABC transporter |
MP637 |
complement(787680..788591) |
| MPN195 |
234508..235812 |
GT9_orf434 |
g1674341 |
GT9_orf434 |
new_conf, similar to cobalt transport membrane protein |
  |
  |
Transporter, ABC superfamily; cobalt transporter subunit; |
MG181 |
MPN431 |
sp: 1..42; tm: 67..87 252..272 384..404; lc: 46..58; |
new_conf Paulsen already classified as ABC transporter membrane protein; sub ABC transporter; Further homolog: MP410 and MG302 |
MP636 |
complement(786383..787687) |
| MPN196 |
235805..236536 |
hisT |
g1674340 |
GT9_orf243V |
conf, pseudouridylate synthase I |
  |
  |
(EC 4.2.1.70) uracil + D-ribose 5-phosphate = pseudouridine 5'-phosphate + H2O |
MG182 |
  |
  |
exp: RNA data from ZMBH, no expression, is hypothetical ! |
MP635 |
complement(785659..786390) |
| MPN197 |
236529..238364 |
pepF |
g1674339 |
GT9_orf611 |
conf, oligoendopeptidase F |
  |
  |
  |
MG183 |
  |
  |
  |
MP634 |
complement(783831..785666) |
| MPN198 |
238364..239323 |
mte1 |
g1674338 |
GT9_orf319V |
conf, adenine-specific methyltransferase EcoRI |
  |
  |
(EC 2.1.1.72) S-adenosyl-L-methionine + DNA adenine = S-adenosyl-L-homocysteine + DNA 6-methylaminopurine |
MG184 |
  |
  |
  |
MP633 |
complement(782872..783831) |
| MPN199 |
239417..241699 |
GT9_orf760 |
g1674337 |
GT9_orf760 |
see: MP631 conserved hypothetical |
  |
  |
  |
MG185 |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200 |
sp: 1..25; lc: 552..568; |
see comments to MP631. |
MP632 |
complement(780496..782778) |
| MPN200 |
241983..244379 |
GT9_orf798 |
g1674335 |
GT9_orf798 |
conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN491, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN199 |
sp: 1..18; cc: 540..565; lc: 228..242; |
No significant homologs other than MP and MG. Family with 15 members. Among the members, MP002, MP336, MP430, MP547, MP551, MP631, MP632 have similarity in whole length with each other. Rest of the members, MP007, MP008, MP056, MP057, MP472, MP473, MP553, MP554, are parts of MP631 (representative). Homolog, but no orthologue in MG: MG185, MG260 exp: RNA data from ZMBH, RNA-expressed; |
MP631 |
complement(777816..780212) |
| MPN201 |
244853..245569 |
GT9_orf238 |
g1674334 |
GT9_orf238 |
conf,see: MP335 |
  |
  |
  |
  |
MPN089, MPN615, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285 |
  |
member of a family of restriction enzymes; 1.7e-20 till res 326 to M.pulmonis restr. system; exp evidence for M.pulmonis in PNAS 95, 13923 (1998) see main representative MP335 |
MP630 |
complement(776626..777342) |
| MPN202 |
246049..246990 |
GT9_orf313 |
g1674333 |
GT9_orf313 |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN286 |
lc: 249..268; |
  |
MP629 |
complement(775205..776146) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN203 |
246909..247292 |
GT9_orf127 |
g1674332 |
GT9_orf127 |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN099, MPN500, MPN409 |
sp: 1..22; lc: 91..105; |
  |
MP628 |
complement(774903..775286) |
| MPN204 |
247655..248101 |
GT9_orf148 |
g1674331 |
GT9_orf148 |
conserved hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP627 |
complement(774094..774540) |
| MPN205 |
248562..249878 |
GT9_orf438V |
g1674330 |
GT9_orf438V |
conf, see: MP013 |
  |
  |
  |
  |
MPN141, MPN128, MPN101, MPN502, MPN462, MPN370 |
lc: 23..38 130..139 169..191 245..259; |
  |
MP626 |
complement(772317..773633) |
| MPN206 |
complement(249933..250274) |
GT9_orf113 |
g1674329 |
GT9_orf113 |
hypothetical |
  |
  |
  |
  |
  |
lc: 63..78; |
Only the N-terminal 62 residues have similarity to M. genitalium hypothetical protein fragment (SPTREMBL Q49241; len=66) with e=1e-04, 45% identity. 63-78, SEG. exp: RNA data from ZMBH, RNA-expressed; |
MP625 |
771921..772262 |
| MPN207 |
250326..253148 |
ptsG |
g1674328 |
GT9_orf940o |
conf, PTS system, glucose-specific IIABC component |
664-692, PTS_EIIB (Pfam); 794-856, PTS_EIIA (Pfam) |
1AX3, 1IBA |
transporter, PTS; sugar transport: glucose, input for glycolysis; |
MG069 |
MPN313, MPN268, MPN259 |
tm: 40..60 85..105 110..130 170..190 209..229 488..508 514..534 537..557 598..618; lc: 240..252 635..647; |
sub PTS; C, B, A domains are in a single chain in this order. |
MP624 |
complement(769047..771869) |
| MPN208 |
253758..254642 |
rpsB |
g1674326 |
G07_orf294 |
conf, ribosomal protein S2 |
  |
  |
  |
MG070 |
  |
cc: 132..160; |
SUB; |
MP623 |
complement(767553..768437) |
| MPN209 |
254635..257253 |
mgtA |
g1674325 |
G07_orf872V |
less, cation-transporting P-type ATPase |
42-62, TM; 83-709, E1-E2_ATPase (Pfam); 736-756, TM; 771-791, TM; 80-826, TM; 839-859, TM |
  |
Transporter, P-type ATPase; cations (Mg++, Ca++) |
MG071 |
  |
tm: 42..62 78..98 243..263 268..288 648..668 688..708 736..756 771..791 806..826 839..859; |
less: Mg2+ is too specific. Most of the Blast hits are cation-transporting ATPase. |
MP622 |
complement(764942..767560) |
| MPN210 |
257240..259666 |
secA |
g1674324 |
G07_orf808 |
conf, preprotein translocase SecA |
6-419, SecA_protein (Pfam) |
  |
  |
MG072 |
  |
  |
sub protein export; One of the components for protein export. Other components are: secY (MP647), secE (MP086?). The intergenic region between MP589 and MP590 seems contain the other component, secG, of this system, because the intergenic region has similarity to yvaL in Bs (FEBS Lett.445;6-8 (1999)), and yavL is similar to secG (J.Bacteriol.181(6):1786-92 (1999)). |
MP621 |
complement(762529..764955) |
| MPN211 |
259641..261614 |
uvrB |
g1674323 |
G07_orf657 |
conf, excinuclease ABC subunit B |
  |
1A1V-A |
  |
MG073 |
MPN443 |
  |
sub excinuclease; One of the three subunits of the ABC excision nuclease. Other subunits are: uvrA (MP223) and uvrC (MP029). |
MP620 |
complement(760581..762554) |
| MPN212 |
261617..262024 |
G07_orf135 |
g1674322 |
G07_orf135 |
conserved hypothetical |
  |
  |
  |
MG074 |
MPN648 |
sp: 1..25; |
1-25, signal peptide. Further homolog: MP194, MG441. PSI-Blast detects nothing other than these 4 homologs. exp: RNA data from ZMBH, RNA-expressed; |
MP619 |
complement(760171..760578) |
| MPN213 |
262129..265221 |
G07_orf1030 |
g1674321 |
G07_orf1030 |
conserved hypothetical |
  |
  |
  |
MG075 |
  |
sp: 1..16; lc: 17..29 567..579 596..619 644..660 893..907; |
No homologs other than MG075. exp: RNA data from ZMBH, RNA-expressed; |
MP618 |
complement(756974..760066) |
| MPN214 |
complement(265218..265634) |
G07_orf138 |
g1674320 |
G07_orf138 |
conserved hypothetical |
  |
  |
  |
MG076 |
MPN046 |
sp: 1..42; tm: 48..68; |
1-42, signal peptide; 48-68, TM; 118-138, TM. PSI-Blast detects nothing other than MG076. exp: RNA data from ZMBH, RNA-expressed; |
MP617 |
756561..756977 |
| MPN215 |
265910..267079 |
oppB |
g1674318 |
G07_orf389a |
conf, oligopeptide transport system permease protein OppB |
  |
  |
Transporter, ABC superfamily; oligopeptide transporter subunit; |
MG077 |
MPN216 |
sp: 1..16; tm: 85..105 116..136 161..181 221..241 265..285; |
sub ABC transporter; |
MP616 |
complement(755116..756285) |
| MPN216 |
267072..268202 |
amiD |
g1674317 |
G07_orf376 |
conf, oligopeptide transport system permease protein AmiD |
  |
  |
Transporter, ABC superfamily; oligopeptide transporter subunit; |
MG078 |
MPN215 |
tm: 46..66 172..192 212..232 239..259 297..317 338..358; |
sub; |
MP615 |
complement(753993..755123) |
| MPN217 |
268204..269475 |
oppD |
g1674316 |
G07_orf423 |
conf, oligopeptide transport ATP-binding protein OppD |
  |
  |
Transporter, ABC superfamily; oligopeptide transporter subunit; |
MG079 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN194, MPN193 |
cc: 147..179; lc: 49..66; |
sub; |
MP614 |
complement(752720..753991) |
| MPN218 |
269438..271993 |
oppF |
g1674315 |
G07_orf851 |
CONF, but only N- and C-term; inbetween (500AA) seg and coil |
  |
  |
apart from big coil region (see comment): Transporter, ABC superfamily; oligopeptide transporter subunit; |
MG080 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN217, MPN194, MPN193 |
cc: 267..290 507..577; |
1-160 and 650-800, are N- and C-term of ATP binding part of oligopeptide ABC transporter. inbetween contains sec and coil, and hits CYTADHERENCE and myosin hits MP526 inbetween thus ... contacted miguel about MP526 annot true but inbetween N- and C-term :oligopeptide ABC transporter ATP binding subunit, AND inbetween (500AA) sec and coil; sub; |
MP613 |
complement(750202..752757) |
| MPN219 |
272049..272462 |
rplK |
g1674314 |
G07_orf137 |
conf, ribosomal protein L11 |
  |
1ACI |
  |
MG081 |
  |
  |
SUB; sub; |
MP612 |
complement(749733..750146) |
| MPN220 |
272462..273142 |
rplA |
g1674313 |
G07_orf226 |
conf, ribosomal protein L1 |
  |
1AD2 |
  |
MG082 |
  |
lc: 122..134; |
SUB; sub; |
MP611 |
complement(749053..749733) |
| MPN221 |
273142..273708 |
pth |
g1674312 |
G07_orf188 |
conf, peptidyl-tRNA hydrolase |
  |
2PTH |
  |
MG083 |
  |
  |
  |
MP610 |
complement(748487..749053) |
| MPN222 |
273701..274570 |
yacA |
g1674311 |
G07_orf289 |
new_conf, similar to PP-loop superfamily ATPase/cell cycle protein MESJ homologues |
  |
1GPM-A |
  |
MG084 |
  |
  |
psi blast hits PP-loop superfamily ATPase/CELL CYCLE PROTEIN MESJ HOMOLOG this gene lies very close to its neighbor (MP608) interaction at the signal transduction level ??? pent in all domains of life.; new_conf more koonin; exp: RNA data from ZMBH, only once at 32 degrees, still doubtful; |
MP609 |
complement(747625..748494) |
| MPN223 |
274571..275509 |
G07_orf312 |
g1674310 |
G07_orf312 |
new_conf, HPr(Ser) kinase |
  |
  |
  |
MG085 |
  |
lc: 140..154; |
new_conf; psi-blast HPr(Ser) kinase full length 26% to MEDLINE 99121006 bettr :30% (BS true ortholog) to MEDLINE 98230327 regulates ... COG1493 latest update also states serine kinase of the HPr. protein; |
MP608 |
complement(746686..747624) |
| MPN224 |
275499..276668 |
lgt |
g1674309 |
G07_orf389b |
more__, prolipoprotein diacylglyceryl transferase but unknown TM contating C-term; bidomainal; |
  |
  |
  |
MG086 |
  |
tm: 25..45 54..74 99..119 147..167 221..241 278..298 310..330; lc: 120..137; |
smart: 7 or 8 TM regions in 389 AA. 1-280 hits prolipoprotein diacylglyceryl transferase C-term hits nothing except MP ortholog, but does contain one probable TM region.; new_conf more koonin, different MG genbankk and TIGR; |
MP607 |
complement(745527..746696) |
| MPN225 |
276697..277116 |
rpsL |
g1674308 |
G07_orf139 |
conf, ribosomal protein S12 |
  |
  |
  |
MG087 |
  |
lc: 9..22; |
SUB; sub; |
MP606 |
complement(745079..745498) |
| MPN226 |
277170..277637 |
rpsG |
g1674307 |
G07_orf155 |
conf, ribosomal protein S7 |
  |
1RSS |
  |
MG088 |
  |
  |
SUB; sub; |
MP605 |
complement(744558..745025) |
| MPN227 |
277660..279726 |
fus |
g1674306 |
G07_orf688 |
conf, elongation factor G |
  |
1DAR |
  |
MG089 |
MPN001, MPN665, MPN279, MPN155 |
  |
  |
MP604 |
complement(742469..744535) |
| MPN228 |
279783..280430 |
rpsF |
g1674305 |
G07_orf215 |
conf, ribosomal protein S6 but seg N-term |
  |
  |
  |
MG090 |
  |
lc: 187..210; |
SUB; sub; |
MP603 |
complement(741765..742412) |
| MPN229 |
280430..280930 |
ssb |
g1674304 |
G07_orf166 |
conf, single-stranded DNA binding protein |
  |
3ULL-B |
  |
MG091 |
  |
  |
  |
MP602 |
complement(741265..741765) |
| MPN230 |
280920..281234 |
rpsR |
g1674303 |
G07_orf104b |
conf, ribosomal protein S18 |
  |
  |
  |
MG092 |
  |
lc: 12..25; |
SUB; sub; |
MP601 |
complement(740961..741275) |
| MPN231 |
281237..281686 |
rplI |
g1674302 |
G07_orf149 |
conf, ribosomal protein L9 |
  |
1DIV |
  |
MG093 |
  |
  |
SUB; |
MP600 |
complement(740509..740958) |
| MPN232 |
281673..283094 |
dnaB |
g1674301 |
G07_orf473 |
conf, replicative DNA helicase DnaB |
  |
1REA |
  |
MG094 |
  |
lc: 133..143; |
exp: RNA data from ZMBH only once 32 degrees, makes sense, restr. enzyme. |
MP599 |
complement(739101..740522) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN233 |
283098..284462 |
G07_orf454 |
g1674300 |
G07_orf454 |
new, excreted conserved protein |
  |
  |
  |
MG095 |
  |
sp: 1..22; lc: 47..64; |
psi-blast iteration hit complexity biased proteins and "antigens" from o.a. plasmodium. hits asparagine rich. lipo not completely clear to me (except for signal of course) unknown. exp: RNA data from ZMBH, RNA-expressed; |
MP598 |
complement(737733..739097) |
| MPN234 |
285190..286443 |
G07_orf417 |
g1674299 |
G07_orf417 |
new, membrane export protein family see: MP334 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508 |
cc: 107..154; |
putative, see MP334 |
MP597 |
complement(735752..737005) |
| MPN235 |
286468..287190 |
ung |
g1674298 |
G07_orf240 |
conf, uracil DNA glycosylase |
  |
1LAU-E |
  |
MG097 |
  |
  |
  |
MP596 |
complement(735005..735727) |
| MPN236 |
287388..288827 |
G07_orf479 |
g1674297 |
G07_orf479 |
more__, Glu-tRNA amidotransferase subunit C AND unknown TM contating N terminal domain; bidomainal; |
  |
  |
  |
MG098 |
  |
tm: 16..36 61..81 106..126 133..153 176..196 229..249 290..310 333..353; |
new_add:We can add the TM observation and discussion; Glu-tRNA amidotransferase subunit C is addition compared to genebank MP but was found in GenebankMG and in Sternberg paper; smart 8 TM regions.; new; 479 long. C term devoid of TM. C term 353/390-479 = gatC (Glu-tRNA amidotransferase subunit C). what does the TM mean ??? (if the orf really includes the TM ...) it could also mean that the process occurs at the plasma membrane... psi-blast with only N-term/middle yields convergence on MG ortholog and with a push hits to all TM regions in NADH reductase etc. |
MP595 |
complement(733368..734807) |
| MPN237 |
288830..290266 |
G07_orf478V |
g1674296 |
G07_orf478V |
more__, Glu-tRNA amidotransferase, subunit A (gatA) |
  |
  |
  |
MG099 |
  |
lc: 116..129; |
hits Glu-tRNA amidotransferase, subunit A (gatA) in psi-blast (see neighbor). hits "MEDLINE 98004482" (from BS) with 31% full length; also included in the MG update; |
MP594 |
complement(731929..733365) |
| MPN238 |
290256..291692 |
PET112 |
g1674295 |
G07_orf478o |
new_conf, Glu-tRNA(Gln) amidotransferase, subunit B (gatB) |
  |
  |
  |
MG100 |
MPN028 |
  |
active in expression at the translational level. lots of the hits in psi-blast are annotated as Glu-tRNA(Gln) amidotransferase, subunit B (gatB). which it IS. hits "MEDLINE 98004482" (from BS) with 35% iden full length; new_conf MG struct other; exp: RNA data from ZMBH, only expression at 32 degree and low, but still believe, is subunit to MP 594 |
MP593 |
complement(730503..731939) |
| MPN239 |
291667..292335 |
K04_orf222 |
g1674294 |
K04_orf222 |
conserved hypothetical |
  |
  |
  |
MG101 |
  |
  |
converges after hitting MG ortholog. exp: RNA data from ZMBH, RNA-expressed; |
MP592 |
complement(729860..730528) |
| MPN240 |
292328..293275 |
trxB |
g1674293 |
K04_orf315 |
conf, thioredoxin reductase |
  |
1BHY |
Biosynthesis of cofactors, prosthetic groups and carrier; Thioredoxin; thioredoxin reductase; thioredoxin (ox) + NADPH = thioredoxin (red) + NADP; |
MG102 |
MPN390 |
lc: 19..34; |
  |
MP591 |
complement(728920..729867) |
| MPN241 |
293265..294107 |
K04_orf280 |
g1674292 |
K04_orf280 |
conserved hypothetical |
  |
  |
  |
MG103 |
  |
  |
converges on hypotethicals in BS, MG, TB and streptomyces exp: RNA data from ZMBH, RNA-expressed; |
MP590 |
complement(728088..728930) |
| MPN242 |
294140..294370 |
  |
New identified |
New identified |
SecG |
  |
  |
  |
  |
  |
  |
  |
589-590 |
complement(727825..728055) |
| MPN243 |
294381..296561 |
vacB |
g1674290 |
K04_orf726 |
new_conf, 3'-5' exoribonuclease, RNase R |
  |
1SRO |
transcription - degradation of RNA |
MG104 |
  |
cc: 597..628; |
new_conf, RNAse R is new; GenebankMG "viral assoc" Sternberg "cold shock DNA binding like" smart: Pfam:RNB 186-556, 597-629 COIL, 641-726 S1 pfam_rnb, The function of this region of similarity is uncertain S1 = Ribosomal protein S1-like RNA-binding domain but indirectly (via prosite + psi-blast) linked to ribonuclease family ... annotation (vacB) points in virulence direction quite correctly, (although first 80 AA hit nothing althoug there might be space for that) vacB = virulence gene, postranscriptional regulator. ribonuclease family?; exp:_COLI 98269059 show for this homologous sequence however, that it it IS a 3'-5' exoribonuclease, RNase R; confirmed also by latest COG update 0537 exoribonuclease; |
MP589 |
complement(725634..727814) |
| MPN244 |
296561..297169 |
K04_orf202 |
g1674289 |
K04_orf202 |
conserved hypothetical |
  |
  |
  |
MG105 |
  |
sp: 1..34; |
hits other hypotheticals in eubacteria and archaea. 202 long. converges on hypotheticals. exp: RNA data from ZMBH, RNA-expressed; |
MP588 |
complement(725026..725634) |
| MPN245 |
complement(297138..297788) |
def |
g1674288 |
K04_orf216 |
CONF, but excreted ? |
  |
1DFF |
  |
MG106 |
  |
sp: 1..24; |
smart signal peptide, and Pfam:Pep_deformylase 40 188 of 216 true. but signal peptide !! in front, excreted ?? |
MP587 |
724407..725057 |
| MPN246 |
297610..298329 |
gmk |
g1674287 |
K04_orf239 |
less, see comments; membrane-associated guanylate kinase homologue |
  |
1GKY |
Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis; if 5'guanylate kinase than ATP + GMP = ADP + GDP. Note: works also with deoxy. if not, see comment, than protein binding, membrane associated; |
MG107 |
  |
sp: 1..30; cc: 187..209; lc: 34..49; |
but if membrane associated: So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions. |
MP586 |
complement(723866..724585) |
| MPN247 |
298329..299108 |
ptc1 |
g1674286 |
K04_orf259 |
conf, protein phoshatase 2C homolog; similar to Swiss-Prot Accession Number P35182, from S. cerevisiae |
  |
1A6Q |
  |
MG108 |
  |
  |
  |
MP585 |
complement(723087..723866) |
| MPN248 |
299099..300268 |
K04_orf389 |
g1674285 |
K04_orf389 |
less, Ser/Thr/Tyr protein kinase |
  |
1APM-E |
  |
MG109 |
  |
tm: 360..380; |
smart: STYKc 15-309 TM 360-380. == Protein kinase; unclassified specificity true only hits this in psi-blast, but can be Ser/Thr/Tyr kinase thus not serine/threonine, but Ser/Thr/Tyr; less; |
MP584 |
complement(721927..723096) |
| MPN249 |
300255..301091 |
yjeQ |
g1674284 |
K04_orf278L |
conserved hypothetical, 154-190 similar to GTP/ATP binding proteins |
  |
  |
  |
MG110 |
  |
  |
hits family of hypothetical proteins in eubacteria hits after iteration the gtp/atp binding sites of other proteins with 154-190 ... -> possible gtp/atp binding; new; exp: RNA data from ZMBH, no expression, is hypothetical ! |
MP583 |
complement(721104..721940) |
| MPN250 |
301113..302405 |
pgiB |
g1674283 |
K04_orf430 |
conf, but first 70 AA |
  |
  |
Energy metabolism, Glycolysis; phosphoglucose isomerase B (pgiB); glucose 6-phosphate = fructose 6-phosphate; |
MG111 |
  |
tm: 384..404; |
only hits glucose 6-phosphate isomerase first 70 only hit MG and nothing else ... annotation is true, but first 70 .... ?? |
MP582 |
complement(719790..721082) |
| MPN251 |
302383..303030 |
cfxE |
g1674282 |
K04_orf215L |
conf, D-ribulose-5-phosphate 3 epimerase |
  |
  |
Energy metabolism, Sugars; D-ribulose-5-phosphate 3 epimerase (cfxE); D-ribulose 5-phosphate = D-xylulose 5-phosphate; |
MG112 |
  |
  |
  |
MP581 |
complement(719165..719812) |
| MPN252 |
303037..304404 |
asnS |
g1674281 |
K04_orf455o |
conf, asparaginyl-tRNA synthetase |
  |
1ASY-A |
  |
MG113 |
MPN046, MPN277 |
  |
  |
MP580 |
complement(717791..719158) |
| MPN253 |
304361..305044 |
pgsA |
g1674280 |
A65_orf227 |
conf, phosphatidylglycerophosphate synthase |
  |
  |
Fatty acid and phospholipid metabolism; phosphatidylglycerophosphate synthase (pgsA); CDP-diacylglycerol + glycerol 3-phosphate = CMP + 3-(3-phosphatidyl)-glycerol 1-phosphate; |
MG114 |
  |
tm: 30..50 59..79 112..132 160..180 194..214; |
  |
MP579 |
complement(717151..717834) |
| MPN254 |
305066..305539 |
  |
New identified |
New identified |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
  |
578-579 |
complement(716656..717129) |
| MPN255 |
305565..306320 |
A65_orf251b |
g1674278 |
A65_orf251b |
conserved hypothetical |
  |
  |
  |
MG116 |
MPN269 |
  |
psi-blast converges after hitting MG ortholog. exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP578 |
complement(715875..716630) |
| MPN256 |
306313..306984 |
A65_orf223 |
g1674277 |
A65_orf223 |
conserved hypothetical |
  |
  |
  |
MG117 |
  |
  |
hits MG ortholog and then converges. exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP577 |
complement(715211..715882) |
| MPN257 |
306965..307981 |
galE |
g1674276 |
A65_orf338 |
conf, UDP-glucose 4-epimerase |
  |
1BXK-A |
Purines, pyrimidines, nucleosides and nucleotides, Sugar-nucleotide biosynthesis and conversions; UDP-glucose 4-epimerase ; UDP-glucose = UDP-galactose . |
MG118 |
  |
  |
exp: RNA data from ZMBH, no expression, is hypothetical; re-check why not expressed ! |
MP576 |
complement(714214..715230) |
| MPN258 |
307996..309714 |
yjcW |
g1674275 |
A65_orf572 |
more_, sugar (ribose/galactose) ABC transporter ATP-binding subunit |
  |
  |
Transporters, ABC superfamily; ribose/galactose transport, subunit; |
MG119 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN609, MPN433, MPN432, MPN416, MPN334, MPN218, MPN217, MPN194, MPN193 |
  |
smart: Pfam:ABC_tran 33-229 AND 355-550 (of 572)., which is the ATP-binding subunit of an ABC transporter. No TM in the protein. most hits are for ribose/galactose. Piece of sequence from 320-360 is "insterted" in the mycoplasma gene ... GALACTOSIDE as substrate experimentaly in E. coli ... stick with "sugar"; more_; sub ABC transporter; exp: RNA data from ZMBH, RNA-expressed; |
MP575 |
complement(712481..714199) |
| MPN259 |
309731..311284 |
A65_orf517 |
g1674274 |
A65_orf517 |
new_conf, sugar (ribose/galactose) ABC transporter permease subunit, but C-term ??? |
  |
  |
Transporters, ABC superfamily; ribose/galactose transport, subunit; |
MG120 |
MPN260 |
tm: 33..53 81..101 104..124 135..155 164..184 217..237 267..287 302..322 325..345 349..369; cc: 490..515; |
517 AA long. 10 TM according to smart. apart from full length hits to MG and Mycoplasma fermentans, Hits to the first 360 AA. Homologs to MP573 with the first 350. first thing the N terminus thus hits are ribose/galactose like ABC transporters ... nice TRUE orthologs are also neighbors. (bv :BS3151 BS3150) rbsC-1, permease protein. C term tail evolves very fast (if only blasting with C-term does not find C-term Mycoplasma fermentans.) C-term ??; new_conf different koonin and genbank MG; sub ABC transporter; |
MP574 |
complement(710911..712464) |
| MPN260 |
311284..312219 |
rbsC |
g1674273 |
A65_orf311 |
conf, sugar (ribose/galactose) ABC transporter permease subunit |
  |
  |
Transporters, ABC superfamily; ribose/galactose transport, subunit; |
MG121 |
MPN259 |
sp: 1..31; tm: 41..61 75..95 149..169 198..218 228..248 251..271 279..299; |
smart: 7-9 TM, long signal pep containing probable TM. 311 long. ABC transporter, 9 TM according to hits to swissprott. For some sugar (ribose/galactose); less; sub ABC transporter; |
MP573 |
complement(709976..710911) |
| MPN261 |
312256..314391 |
topA |
g1674272 |
A65_orf711 |
conf, DNA topoisomerase I |
  |
1ECL |
  |
MG122 |
  |
lc: 58..69; |
  |
MP572 |
complement(707804..709939) |
| MPN262 |
314381..315808 |
A65_orf475 |
g1674271 |
A65_orf475 |
conserved hypothetical, similar to reticulocyte binding protein |
  |
  |
  |
MG123 |
  |
sp: 1..44; |
475 AA. smart: signal 1-40 probable TM in 20-40 ... after many iterations -> myosins Hits at first nothing except its MG homolog. Thereafter (i)the RETICULOCYTE BINDING PROTEIN comes in (a huge plasmodium protein) this protein should be involevd in the specific binding to and and recognition of target cells ... (ii) Dictyostelium discoideum containing leucine zipper-like domains and a AQ protein (aq_1732) with no annotation at all., except for signal and lots of SEG. all hits could be false positives (low complexity guys) |
MP571 |
complement(706387..707814) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN263 |
315874..316182 |
trx |
g1674270 |
A65_orf102 |
conf, thioredoxin |
  |
1AIU |
Biosynthesis of cofactors, prosthetic groups and carrier; Thioredoxin;thioredoxin;redox substrate; |
MG124 |
  |
  |
  |
MP570 |
complement(706013..706321) |
| MPN264 |
316194..317039 |
A65_orf281 |
g1674269 |
A65_orf281 |
new_conf, 150-end, similar to phosphate hydrolising |
  |
  |
  |
MG125 |
MPN427, MPN383 |
lc: 3..14; |
281 AA; smart: Pfam:DUF3 4-265. = "Domain apparently occurring exclusively in eubacteria. Unknown function." many homologs; all unknown function. after iteration 2 the phosphoserine phosphatase (first) and transportATPase come in ... the phosphoserine phosphatase hits are in the 200-end region ... the transportATPase more 150-end ... orthophospate removing ... hydrolase of phospahte binding ...; new_conf koonin MG; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP569 |
complement(705156..706001) |
| MPN265 |
complement(317047..318087) |
trpS |
g1674268 |
A65_orf346 |
conf, tryptophanyl-tRNA synthetase |
  |
1TYA-E |
  |
MG126 |
  |
  |
  |
MP568 |
704108..705148 |
| MPN266 |
318144..318581 |
ygl1 |
g1674267 |
A65_orf145 |
new_conf, similar to (oxido/arsenate) reductase |
  |
  |
  |
MG127 |
  |
  |
hits first hypo'd then (after it.) ARSENATE REDUCTASE ... all ARSENATE REDUCTASE are more similar to each other th;an to the small family of hypo's containing MP567 ... -> (oxido) reductase ... some species (for exa EC) contain the real ARSENATE REDUCTASE and the MP567 ortholog.;new_conf koonin MG; exp: RNA data from ZMBH, RNA-expressed; |
MP567 |
complement(703614..704051) |
| MPN267 |
318581..319360 |
A65_orf259 |
g1674266 |
A65_orf259 |
conserved hypothetical |
  |
  |
  |
MG128 |
  |
  |
hits full length (259) all kinds of hyotheticals in all kinds of organisms ... ultimatly converges only on hypo's ... exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP566 |
complement(702835..703614) |
| MPN268 |
319360..319713 |
A65_orf117 |
g1674265 |
A65_orf117 |
new_conf, similar to PTS system: EIIB and N-term part of EIIC; bidomainal; |
  |
1IBA |
  |
MG129 |
MPN207 |
sp: 1..26; |
hits of course first MG ortholog then hits PTS system II, first hits are to glucose specific ... NOT EIIA DOMAIN, is EIIB DOMAIN ... and 30 AA cterm of EIIC oid. can be reciprocally found by iterative psi-blast. contains probably phosphorylation site. pdb hit = pdb 1IBA; to be phosphyrilated Cysteine aligns with serine ?? and is thus not conserved. remember hits are not obvious, are distant. partial homolog = MP624. IIC is supposed to bind and transport the suger. seems true orthology because of lack of alternatives in MP ... First 20AA are according to annotated psi-blast hits TM. But not according to smart.;new_conf koonin, EMBL MG, EMBL structure, genbank MG; sub PTS system; |
MP565 |
complement(702482..702835) |
| MPN269 |
319703..321184 |
ysr1 |
g1674264 |
A65_orf493 |
conf, nucleotide binding protein |
  |
  |
  |
MG130 |
  |
sp: 1..41; cc: 63..94; |
493 AA, smart long signal (40), this signal in its last 20AA contains probable TM. 63 95 coils ... Second iteration -> myosins ... C term hits hypotheticals (clear family in eubact) and then coiled mess. ?; Iterations of pis-blast with N-term hit different nucleotide binding proteins. exp: RNA data from ZMBH, RNA-expressed; |
MP564 |
complement(701011..702492) |
| MPN270 |
321187..321474 |
  |
New identified |
New identified |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
  |
563-564 |
complement(700721..701008) |
| MPN271 |
321736..322491 |
A65_orf251a |
g1674262 |
A65_orf251a |
see: MP199 conserved hypothetical |
  |
  |
  |
  |
MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN332 |
sp: 1..31; |
  |
MP563 |
complement(699704..700459) |
| MPN272 |
324197..324478 |
  |
A65_orf94 |
A65_orf94 |
hypothetical |
  |
  |
  |
  |
  |
  |
  |
MPN272 |
complement(697717..697998) |
| MPN273 |
complement(324455..324889) |
hit1 |
g1674261 |
A65_orf144 |
new_conf, nucleotidyl hydrolases/transferase |
  |
1GUP-A |
  |
MG132 |
  |
  |
BELONGS TO THE HIT FAMILY -> histidine triad -> unifying the HIT family as nucleotidyl hydrolases, transferases, or both. Also called PROTEIN KINASE C INHIBITOR omni-pent family; new_conf EMBL structure, as well as described by Sternberg; exp: RNA data from ZMBH, RNA-expressed; |
MP562 |
697306..697740 |
| MPN274 |
complement(324858..325658) |
A65_orf266 |
g1674260 |
A65_orf266 |
new, ABC transporter (sulfate/molybdenum) permease subunit |
  |
  |
  |
MG133 |
MPN666 |
sp: 1..40; tm: 89..109 151..171 232..252; |
smart: very long signal peptide. 3 or 5 TM regions ... only 266 AA long. part of signal might also be TM -> probably at least 4 TM first hits only MG orthologs + MP and MG homologs (see also MP homolog: MP176) after a while start hitting TRANSPORTERS. ABC/SULFATE(full)/MOLYBDENUM(start at 70) hits translocation; sub ABC transporter; new; |
MP561 |
696537..697337 |
| MPN275 |
325680..325982 |
yaaK |
g1674259 |
A65_orf100 |
conserved hypothetical |
  |
  |
  |
MG134 |
  |
  |
SMART: nothing (its is short 100AA) nice family of hypotheticals can be founs after iterations. hits very vaguely a putative cytoplasmic protein ... hits nothing else except family members form different species and then converges. exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP560 |
complement(696213..696515) |
| MPN276 |
complement(325954..326811) |
A65_orf285 |
g1674258 |
A65_orf285 |
conserved hypothetical |
  |
  |
  |
MG135 |
  |
tm: 31..51 84..104 108..128 150..170 173..193 236..256; |
6 TM regions in a 285 AA prot .. only hits MG and (Mycoplasma gallisepticum) and then converges ... exp: RNA data from ZMBH, RNA-expressed; |
MP559 |
695384..696241 |
| MPN277 |
326856..328325 |
lysS |
g1674257 |
A65_orf489 |
conf, lysyl-tRNA synthetase |
  |
1LYL-A |
  |
MG136 |
MPN046, MPN252 |
  |
  |
MP558 |
complement(693870..695339) |
| MPN278 |
328285..329484 |
yefE |
g1674256 |
A65_orf399V |
new_conf, udp-galactopyranose mutase |
  |
1AOG-A |
  |
MG137 |
  |
  |
smart: nothing UDP-GALACTOPYRANOSE MUTASE full length hit to experminetal determined GLF_ECOLI; new_conf differnt/more than TIGR koonin; new_conf exactly this in swiss prot; UI 96165258; |
MP557 |
complement(692711..693910) |
| MPN279 |
329484..331229 |
lepA |
g1674255 |
A65_orf581 |
conf, GTP-binding membrane protein LepA |
  |
1AIP, 2EFG-A |
  |
MG138 |
MPN665, MPN481, MPN227, MPN155 |
  |
  |
MP556 |
complement(690966..692711) |
| MPN280 |
331360..333069 |
A65_orf569 |
g1674253 |
A65_orf569 |
new, similar to single stranded RNA(DNA) processing enzymes |
  |
1BC2-A |
  |
MG139 |
MPN621 |
lc: 32..47; |
new; SMART: 18 223 Pfam:lactamase_B superfamily thing hits distantly putative single strand RNA/DNA editing enzymes ... see also C12_orf561 !, is family of unknowns in eubacteria and archaea CLEAVAGE AND POLYADENYLATION and ATP binding start to surface ... hits 14-434 (of 569) in bos taurus MEDLINE 97078155; new, differnt from koonin and tobias; cons. hyp GenebankMG; Zn metallo-beta-lactamase Sternberg; COG595 predicts metal hydrolase 3; (consistent with our prediction, we think we can be more specific;) |
MP555 |
complement(689126..690835) |
| MPN281 |
333280..334413 |
A65_orf377 |
g1674252 |
A65_orf377 |
see: MP631 conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN200, MPN199 |
sp: 1..21; lc: 246..258; |
see comments to MP631. |
MP554 |
complement(687782..688915) |
| MPN282 |
334768..335268 |
A65_orf166 |
g1674251 |
A65_orf166 |
see: MP631, conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN147, MPN098, MPN097, MPN506, MPN408, MPN364, MPN288, MPN284, MPN200, MPN199 |
lc: 57..70; |
see comments to MP631. |
MP553 |
complement(686927..687427) |
| MPN283 |
336479..336826 |
A65_orf115 |
g1674250 |
A65_orf115 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
lc: 43..55; |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP552 |
complement(685369..685716) |
| MPN284 |
337770..340154 |
A65_orf794 |
g1674249 |
A65_orf794 |
see: MP631 conserved hypothetical |
  |
  |
  |
MG260 |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN282, MPN281, MPN200, MPN199 |
sp: 1..18; lc: 218..236 462..475; |
see comments to MP631. |
MP551 |
complement(682041..684425) |
| MPN285 |
340613..341533 |
prrB |
g1674248 |
A65_orf306 |
conf, type I restriction enzyme ecokI specificity protein see: MP335 |
  |
  |
  |
  |
MPN089, MPN638, MPN615, MPN567, MPN507, MPN365, MPN343, MPN290, MPN289, MPN201 |
lc: 26..87; |
member of a family of restriction enzymes; 1.7e-20 till res 326 to M.pulmonis restr. system; exp evidence for M.pulmonis in PNAS 95, 13923 (1998) |
MP550 |
complement(680662..681582) |
| MPN286 |
341636..343033 |
A65_orf465V |
g1674246 |
A65_orf465V |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN202 |
lc: 20..37 59..71 111..131 157..171 257..281 389..401; |
  |
MP549 |
complement(679162..680559) |
| MPN287 |
343764..344120 |
A65_orf118 |
g1674245 |
A65_orf118 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URFexp: RNA data from ZMBH, RNA-expressed; |
MP548 |
complement(678075..678431) |
| MPN288 |
344716..347079 |
A65_orf787o |
g1674244 |
A65_orf787o |
see: MP631 conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN284, MPN282, MPN281, MPN200, MPN199 |
sp: 1..27; cc: 537..557; lc: 231..267 467..479; |
see comments to MP631. exp: 2D-Gel data from ZMBH TX-UF, auf Gel ca. 31 kD, IEP 5.6; RNA data from ZMBH only once at 32 degrees; |
MP547 |
complement(675116..677479) |
| MPN289 |
347169..347732 |
hsdS1B |
g1674243 |
H10_orf187V |
conf, this protein specifications means only that it is a type I restriction with enzyme ecokI specificity protein see: MP335 |
  |
  |
  |
  |
MPN089, MPN615, MPN507, MPN365, MPN343, MPN290, MPN285, MPN201 |
lc: 149..166; |
family, see main representative MP335 |
MP546 |
complement(674463..675026) |
| MPN290 |
347871..348308 |
H10_orf145L |
g1674242 |
H10_orf145L |
conf,see: MP335 |
  |
  |
  |
  |
MPN089, MPN615, MPN507, MPN365, MPN343, MPN289, MPN285, MPN201 |
  |
family, see main representative MP335 |
MP545 |
complement(673887..674324) |
| MPN291 |
complement(348301..348891) |
H10_orf196 |
g1674241 |
H10_orf196 |
conserved hypothetical |
  |
  |
  |
MG208 |
MPN478 |
  |
hits only MG counterpart exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP544 |
673304..673894 |
| MPN292 |
complement(348875..349804) |
yceC |
g1674240 |
H10_orf309 |
new_conf, similar to RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D |
  |
  |
  |
MG209 |
MPN548 |
lc: 144..156; |
SUB; mart: PFAM: YABO = hypthetical function hits (also links of YABO) to RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D ... hits to experimentaaly confirmed RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D; exp in EC seem VERY significant after one iteration UI 98325071; new_conf tobias MG; exp: RNA data from ZMBH, RNA-expressed; |
MP543 |
672391..673320 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN293 |
complement(349804..350358) |
lsp |
g1674239 |
H10_orf184 |
conf, prolipoprotein signal peptidase |
  |
  |
  |
MG210 |
  |
sp: 1..47; tm: 92..112 156..176; |
20-160 (of 180) indeed true as given prolipoprotein signal peptidase |
MP542 |
671837..672391 |
| MPN294 |
350397..351017 |
H10_orf206 |
g1674238 |
H10_orf206 |
new_conf, similar to intracellular protease |
  |
  |
  |
  |
  |
  |
Hits after iterations: PFPI_PYRFU a PROTEASE, belonging to the THIJ/PFPI FAMILY PFPI_PYRFU contains hard medline refernce ... but hits many other proteins after that iteration ... (rna binding AND -methyl-5(b-hy droxyethyl -thiazole monophosphate biosynthesis enzyme) ...proteases appaer first by a big significance differnce. actually all the putative functions are one big family ... MP is most similar to protease, seems to fall in that COG (is remotely similar to MP122 (B01_orf108), hydrolase), hits medline 96196168; new_conf, confirmed also by putative intracellular protease, COG 0693; |
MP541 |
complement(671178..671798) |
| MPN295 |
351066..351728 |
H10_orf220L |
g1674237 |
H10_orf220L |
conserved hypothetical |
  |
  |
  |
MG210.1 |
  |
  |
only hits the MG ortholog and then CONVERGES ..... REALLY smart: SEG exp: RNA data from ZMBH, RNA-expressed; 2d-Gel-PH: TX-UF. Ges.; |
MP540 |
complement(670467..671129) |
| MPN296 |
351728..351910 |
  |
New identified |
New identified |
ribosomal protein S21 |
  |
  |
  |
  |
  |
  |
  |
539-540 |
complement(670285..670467) |
| MPN297 |
351935..352384 |
H10_orf149 |
g1674235 |
H10_orf149 |
conserved hypothetical |
  |
  |
  |
MG211 |
  |
cc: 53..89; |
Only close homolog is from MG. Converges on that one in PSI-blast sub significant hits are all glutamate rich ... and should thus be discarded smart: coils exp: RNA data from ZMBH, RNA-expressed; 2d-Gel-PH: TX-UF; |
MP539 |
complement(669811..670260) |
| MPN298 |
352387..352746 |
H10_orf119 |
g1674234 |
H10_orf119 |
new_conf, similar to holo-acyl-carrier protein synthase |
  |
  |
  |
MG211.1 |
  |
  |
N term part 1-65 hits holo-acyl-carrier protein synthase ... after third ietration hits become full length. also reciprocally it is hit. [FUNCTION] TRANSFERS THE 4'-PHOSPHOPANTETHEINE MOIETY FROM COENZYME A TO THE SER-36 OF ACYL-CARRIER PROTEIN. [CATALYTIC ACTIVITY] COA + APO-[ACYL-CARRIER PROTEIN] = ADENOSINE 3',5'-BISPHOSPHATE + HOLO-[ACYL-CARRIER PROTEIN]. [COFACTOR] REQUI MG(2+). [SUBUNIT] HOMODIMER. IF it is anything it is likely something like this, hits medline 96027548; new_conf, COG0736, acyl carrier protein synthase; |
MP538 |
complement(669449..669808) |
| MPN299 |
352734..353534 |
plsB |
g1674233 |
H10_orf266 |
conf, 1-acyl-sn-glycerol-3-phosphate acyltransferase |
  |
  |
Fatty acid and phospholipid metabolism; Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate; |
MG212 |
  |
sp: 1..39; |
confirmed by psi-blast (unless all false annotations or it makes no sense in context) Synonim: LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE (1-ACYLGLYCEROL- 3-PHOSPHATE O-ACYLTRANSFERASE) might be over prediction ????, context .. |
MP537 |
complement(668661..669461) |
| MPN300 |
353535..355055 |
dyr |
g1674232 |
H10_orf506 |
conf, bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical |
1-157 matches completely Dihydrofolate Reductase; 160-400 matches 21-238 of bacterial family member 250 aa proteins (e.g. YPUG_BACSU); 400-506 no matches appart of MG homolog. |
1VDR-A |
Biosynthesis of cofactors, prosthetic groups and carrier;Folic acid; but dihyrofolate reductase (DYR) homolog protein; reaction similar to 5,6,7,8-tetrahydrofolate + NADP = 7,8-dihydrofolate + NADPH |
MG213 |
MPN321 |
cc: 247..269 427..460; |
story: N-terminal matches Dihydrofolate Reductase but another part is a bacterial family of hypothetical proteins (multidomain or artifact) exp: RNA data from ZMBH, 32 degrees once, RNA-expressed; |
MP536 |
complement(667140..668660) |
| MPN301 |
355039..355665 |
ypuH |
g1674231 |
H10_orf208 |
conserved hypothetical |
  |
  |
  |
MG214 |
  |
  |
bacterial family; bacterial family; expandable with PSI-BLAST exp: RNA data from ZMBH, RNA-expressed; |
MP535 |
complement(666530..667156) |
| MPN302 |
355685..356671 |
pfk |
g1674230 |
H10_orf328 |
conf, 6-phosphofructokinase |
  |
3PFK |
Energy metabolism, Glycolysis; 6-phosphofructokinase (pfk); fructose 6-phosphate + ATP = Fructose 1,6-biphosphate; note: This twin MP533/MP534 (other glycolysis twin MP213/MP214) - evolutionary implications ? regulation ? |
MG215 |
  |
  |
  |
MP534 |
complement(665524..666510) |
| MPN303 |
356677..358203 |
pyk |
g1674229 |
H10_orf508 |
conf, pyruvate kinase |
  |
1A3W-A |
Energy metabolism, Glycolysis;pyruvate kinase (pyk); phosphoenol pyruvate and ADP = pyruvate + ATP; |
MG216 |
  |
  |
  |
MP533 |
complement(663992..665518) |
| Cys-tRNA(TGC) |
358241..358319 |
mptgc |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
358241..358319 |
complement(663876..663954) |
| Pro-tRNA(CCA) |
358371..358447 |
mptgc |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
358371..358447 |
complement(663748..663824) |
| Met-tRNA(ATG) |
358456..358528 |
mptgc |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
358456..358528 |
complement(663667..663739) |
| Ile-tRNA(ATG) |
358539..358614 |
mptgc |
  |
  |
in Genbank, /note="codon recognized: CAT" is wrong. |
  |
  |
  |
  |
  |
  |
  |
358539..358614 |
complement(663581..663656) |
| Ser-tRNA(TCA) |
358655..358745 |
mptgc |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
358655..358745 |
complement(663450..663540) |
| fMet-tRNA(ATG) |
358758..358834 |
mptgc |
  |
  |
in Genbank, /product="tRNA-Met" is wrong. |
  |
  |
  |
  |
  |
  |
  |
358758..358834 |
complement(663361..663437) |
| Asp-tRNA(GAC) |
358836..358909 |
mptgc |
  |
  |
in Genbank, /product="tRNA-Asn" is wrong. |
  |
  |
  |
  |
  |
  |
  |
358836..358909 |
complement(663286..663359) |
| Phe-tRNA(TTC) |
358911..358986 |
  |
  |
  |
in Genbank, "gene" missing. Maybe gene = "mptgc" |
  |
  |
  |
  |
  |
  |
  |
358911..358986 |
complement(663209..663284) |
| MPN304 |
359183..359899 |
arcA |
g1674228 |
H10_orf238 |
less, (N-terminal, fragment) |
  |
  |
Energy metabolism; Amino acids and amines; N-terminal fragment; arginine + H2O = citrullin + NH3; note with MP531 above only; there is another arginine deiminase or arginine dehydrolase at MP 282; |
  |
MPN560 |
  |
matches ARCA_MYCAR 4-194; exp: Chromosomal and other re-sequencing suggests that this frameshift is real; the fragments here are probably pseudogenes (subsequent loss) and/or in the process of acquiring a new function |
MP532 |
complement(662296..663012) |
| MPN305 |
359800..360396 |
arcA |
g1674227 |
H10_orf198 |
less, (C-terminal, fragment) |
  |
  |
Energy metabolism; Amino acids and amines; C-terminal fragment; arginine + H2O = citrullin + NH3 |
  |
MPN560 |
  |
matches ARCA_MYCAR 210-407; exp: Chromosomal and other re-sequencing suggests that this frameshift is real; there is MP282 as a complete arginine deiminase; the fragments here are probable pseudogenes(subsequent loss) and/or in the process of acquiring a new function |
MP531 |
complement(661799..662395) |
| MPN306 |
360644..361465 |
argI |
g1674226 |
H10_orf273o |
less (fragment) |
  |
1A1S |
Energy metabolism, Amino acids and amines; if the first 70 AA do not matter (see comment) this works as ornithine carbamoyl transferase (otc1); carbamoyl-phosphate + ornithine = phosphate + citrulline; |
  |
  |
  |
first 70 aa of the ornithine carbamoyl transferase are not matched (sequence-error?); Mikita has an N-terminal extension; |
MP530 |
complement(660730..661551) |
| MPN307 |
361468..362397 |
arcC |
g1674225 |
F10_orf309 |
conf, carbamate kinase (EC 2.7.2.2) |
  |
  |
Energy metabolism, Amino acids and amines; carbamate kinase; ATP + NH3 + CO2 = ADP + carbamoyl-phosphate; |
  |
  |
lc: 185..191 287..300; |
  |
MP529 |
complement(659798..660727) |
| MPN308 |
362400..364097 |
F10_orf565 |
g1674224 |
F10_orf565 |
new_conf, aa_permeases see: MP058 |
  |
  |
Transporters, probably APC family like; amino acid permease |
  |
MPN096, MPN095 |
sp: 1..23; tm: 43..63 95..115 137..157 172..192 227..247 268..288 311..331 371..391 424..444 460..480 515..535; |
new_conf; Pfam:aa_permeases (Evalue - 0.64) See pfam alignment. further confirmed by COG531 |
MP528 |
complement(658098..659795) |
| MPN309 |
364231..365448 |
P65 |
g1674222 |
F10_orf405 |
conserved hypothetical |
  |
  |
  |
MG217 |
MPN452 |
cc: 253..319; lc: 52..72; |
less: P65 is not a function, it is hypothetical; only homologs in MP and MG exp: RNA data from ZMBH, RNA-expressed; part of the cytadherence regulatory locus protein with MW 65 kDa. cytadherence operon-like |
MP527 |
complement(656747..657964) |
| MPN310 |
365468..370924 |
F10_orf1818 |
g1674221 |
F10_orf1818 |
new_conf, Cytadherence High Molecular Weight Protein 2 (SwissProt HMW2_MYCPN) |
  |
  |
  |
MG218 |
MPN474, MPN387 |
cc: 39..69 102..177 256..285 314..562 618..865 926..1068 1173..1273 1367..1416 1503..1606 1644..1755 1787..1814; lc: 1756..1784; |
new_conf; this protein is HMW2_MYCPN 97252497 J. BACTERIOL. 179:2668-2677(1997); koonin said only coiled coil; most of the protein is coiled coil; hmw2 recognized also by Sternberg, GenebankMG and swissprot; note that this protein is the center of the crl, the cytadherence regulatory locus; Hedreyda and Krause, 1995; Infect.Immun 63, 3479-3483. Tn4001 insertions in crl have a polar effect on the expression of flanking genes and also result in loss of HMW1 and HMW3 and a cytadherence negative phenotype; cytadherence operon-like; |
MP526 |
complement(651271..656727) |
| MPN311 |
370939..372012 |
F10_orf357 |
g1674220 |
F10_orf357 |
conserved hypothetical |
  |
  |
  |
MG218.1 |
  |
cc: 196..220; lc: 57..70 289..317; |
only a MG homolog exp: RNA data from ZMBH, 32 degrees,RNA-expressed; cytadherence regulatory locus protein with MW 41 kDa; cytadherence operon-like |
MP525 |
complement(650183..651256) |
| MPN312 |
372002..372658 |
F10_orf218 |
g1674219 |
F10_orf218 |
hypothetical |
  |
  |
  |
  |
  |
lc: 107..132; |
no homologue; URF, although according to Krause et. al. J. Bact 1997 2668-2677 there is a protein expressed (bs); exp: RNA data from ZMBH, RNA-expressed; cytadherence regulatory locus protein with MW 24 kDa; cytadherence operon-like |
MP524 |
complement(649537..650193) |
| MPN313 |
complement(372741..373013) |
F10_orf90 |
g1674218 |
F10_orf90 |
conserved hypothetical |
  |
  |
  |
MG220 |
MPN207 |
tm: 12..32; |
Only homolog in MG by PSI-BLAST; Homolog in MG, GeneBank and TYGR say pre-procytotoxin (?), Koonin says hypothetical exp: RNA data from ZMBH, 32 degrees,RNA-expressed; |
MP523 |
649182..649454 |
| Arg-tRNA(CGC) |
373083..373159 |
mptgac |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
373083..373159 |
complement(649036..649112) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN314 |
373414..373839 |
yabB |
g1674217 |
F10_orf141b |
conserved hypothetical |
  |
  |
  |
MG221 |
  |
  |
Conserved bacterial family exp: RNA data from ZMBH, RNA-expressed; |
MP522 |
complement(648356..648781) |
| MPN315 |
373829..374755 |
yabC |
g1674216 |
F10_orf308 |
new_conf, SAM-Dependent Methytransferase (Koonin for MG ortholog) |
  |
  |
  |
MG222 |
  |
lc: 180..192; |
new_conf Koonin for MG ortholog; 2nd PSI-BLAST iteration hits characterized members MTA1_ACICA 91345839 Agric. Biol. Chem. 55 (6), 1553-1559 (1991); exp MTA1_ACICA 91345839 exp: RNA data from ZMBH, RNA-expressed; |
MP521 |
complement(647440..648366) |
| MPN316 |
374758..376017 |
F10_orf419 |
g1674215 |
F10_orf419 |
conserved hypothetical |
  |
  |
  |
MG223 |
  |
lc: 328..342; |
only MP MG exp: RNA data from ZMBH,RNA-expressed; |
MP520 |
complement(646178..647437) |
| MPN317 |
376023..377165 |
ftsZ |
g1674214 |
F10_orf380 |
conf, cell division protein FtsZ |
  |
1FSZ |
  |
MG224 |
  |
  |
exp: RNA data from ZMBH only once low at 32 degrees, is hypothetical ! Why: Because only activated at cell division. |
MP519 |
complement(645030..646172) |
| MPN318 |
377208..378683 |
F10_orf491 |
g1674213 |
F10_orf491 |
conf,(amino acid permease) |
  |
  |
Transporters, APC family; amino acid permease; |
MG225 |
MPN319 |
tm: 12..32 39..59 98..118 129..149 163..183 203..223 241..261 288..308 347..367 380..400 421..441 453..473; |
homologue to MP517 exp: RNA data from ZMBH,RNA-expressed; |
MP518 |
complement(643512..644987) |
| MPN319 |
378658..380169 |
gap1 |
g1674212 |
F10_orf503 |
conf, general amino acid permease GAP1 homolog; similar to Swiss-Prot Accession Number P19145, from S. cerevisiae |
  |
  |
Transporters, APC family; amino acid permease; |
MG226 |
MPN318 |
tm: 20..40 46..66 106..126 136..156 166..186 210..230 247..267 301..321 360..380 406..426 443..463 468..488; |
homologue to MP518 |
MP517 |
complement(642026..643537) |
| MPN320 |
380541..381527 |
thyA |
g1674210 |
F10_orf328 |
conf, thymidylate synthase |
  |
1AN5-A |
  |
MG227 |
  |
  |
Bairoch: Protein starts in fact at MQQYLDLARYVLEHGKYRP ... so about 40 aa shorter at N-terminus; Mikita sees again only a one bp intergenic region (but not more). |
MP516 |
complement(640668..641654) |
| MPN321 |
381529..382011 |
dhfr |
g1674209 |
F10_orf160 |
conf, dihydrofolate reductase (EC 1.5.1.3) |
  |
1DDR-A |
Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; dihydrofolate reductase (dhfr); 5,6,7,8-tetrahydrofolate + NADP = 7,8-dihydrofolate + NADPH; |
MG228 |
MPN300 |
  |
  |
MP515 |
complement(640184..640666) |
| MPN322 |
382018..383037 |
nrdF |
g1674208 |
F10_orf339 |
more_, ribonucleoside-diphosphate reductase beta chain |
  |
1MRR-A |
Purines, pyrimidines, nucleosides and nucleotides, 2'-Deoyribonucleotide metabolism; ribonucleoside-diphosphate reductase (nrdE); requires further subunit, but MP514 is in such an operon, see comment; 2'-deoxyribonucleoside diphosphate + oxidized thioredoxin +H2O = ribonucleoside diphosphate + reduced thioredoxin; |
MG229 |
  |
lc: 178..192; |
more_ beta subunit; sub: ribonucleoside-diphosphate reductase; operon MP512/MP513/MP514 |
MP514 |
complement(639158..640177) |
| MPN323 |
383040..383501 |
F10_orf153 |
g1674207 |
F10_orf153 |
new_conf, probably nrdI |
  |
  |
  |
MG230 |
  |
  |
tentative but part of a ribonucleoside-diphosphate reductase operon present also in E. coli, B. subtilis, S. typhimirium, L. lactis, etc; homolog (no function) NRDI_BACSU 97124182 MICROBIOLOGY 142:2995-3004(1996) operon MP512/MP513/MP514; operon comparison in 98136125 J. Biol. Chem. 273:4329-4337(1998) Figure 2; COG1780; Sternberg; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP513 |
complement(638694..639155) |
| MPN324 |
383525..385690 |
nrdE |
g1674206 |
F10_orf721 |
more_, ribonucleoside-diphosphate reductase alpha chain |
  |
5R1R-A |
Purines, pyrimidines, nucleosides and nucleotides, 2'-Deoyribonucleotide metabolism; ribonucleoside-diphosphate reductase (nrdE); requires further subunit, but MP512 is in such an operon, see comment; 2'-deoxyribonucleoside diphosphate + oxidized thioredoxin +H2O = ribonucleoside diphosphate + reduced thioredoxin; |
MG231 |
  |
  |
more_ alpha subunit; sub: ribonucleoside-diphosphate reductase; operon MP512/MP513/MP514 |
MP512 |
complement(636505..638670) |
| MPN325 |
385837..386139 |
rpl21 |
g1674205 |
F10_orf100b |
conf, ribosomal protein L21 |
  |
  |
  |
MG232 |
  |
  |
SUB; sub: ribosomal |
MP511 |
complement(636056..636358) |
| MPN326 |
386132..386434 |
ysxB |
g1674204 |
F10_orf100a |
conserved hypothetical |
  |
  |
  |
MG233 |
  |
tm: 24..44; |
small bacterial family with members in MP MG B. subtilis and T. pallidum exp: RNA data from ZMBH, RNA-expressed; |
MP510 |
complement(635761..636063) |
| MPN327 |
386427..386741 |
rpl27 |
g1674203 |
F10_orf104 |
conf, ribosomal protein L27 |
  |
  |
  |
MG234 |
  |
  |
SUB; sub: ribosomal |
MP509 |
complement(635454..635768) |
| MPN328 |
386734..387594 |
nfo |
g1674202 |
F10_orf286 |
conf, endonuclease IV |
  |
1DID-A, 1BHW-A |
  |
MG235 |
  |
  |
  |
MP508 |
complement(634601..635461) |
| MPN329 |
387548..388024 |
F10_orf158 |
g1674201 |
F10_orf158 |
new_conf, Ferric uptake regulator (Koonin for MG homologue) |
  |
  |
  |
MG236 |
  |
  |
new_conf (Koonin for MG homologue); exp 98164360 FUR_HELPY |
MP507 |
complement(634171..634647) |
| MPN330 |
388014..388898 |
F10_orf294 |
g1674200 |
F10_orf294 |
conserved hypothetical |
  |
  |
  |
MG237 |
  |
  |
exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP506 |
complement(633297..634181) |
| MPN331 |
388923..390257 |
tig |
g1674199 |
F10_orf444 |
conf, trigger factor |
  |
1BKF |
  |
MG238 |
  |
  |
exp,expPH: N-terminal sequence was MKQYNTDNTE [instead of of predicted MKQYKLVNTTQKE] 2D Gel weight was 55kD instead of 51kD predicted |
MP505 |
complement(631938..633272) |
| MPN332 |
390328..392715 |
lon |
g1674198 |
F10_orf795 |
conf, ATP-dependent protease Lon |
  |
1D2N-A |
  |
MG239 |
MPN271 |
lc: 33..47 304..308 591..604; |
  |
MP504 |
complement(629480..631867) |
| MPN333 |
392910..395162 |
F10_orf750 |
g1674196 |
F10_orf750 |
hypothetical see: MP501 |
  |
  |
  |
  |
MPN491, MPN335 |
sp: 1..49; tm: 79..99 118..138 143..163 724..744; cc: 546..587; |
less: no homolog appart from MP503; no idea from where the original annotation came; exp: RNA data from ZMBH, RNA-expressed; |
MP503 |
complement(627033..629285) |
| MPN334 |
395165..396145 |
bcrA |
g1674195 |
F10_orf326 |
new_conf, ABC transporter ATP-binding protein |
  |
  |
Transporter, ABC family, function ?; |
  |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN258, MPN218, MPN217, MPN194, MPN193 |
  |
new_conf pfam 35-215 Pfam:ABC_tran; C-terminal 80 residues not conserved (not even in MG), probably missing stop codon; exp 96146051 ECSA_BACSU |
MP502 |
complement(626050..627030) |
| MPN335 |
396132..398357 |
F10_orf741 |
g1674194 |
F10_orf741 |
hypothetical see: MP503 |
  |
  |
  |
  |
MPN491, MPN333 |
tm: 38..58 73..93 120..140 157..177 185..205 715..735; cc: 404..431 626..647; lc: 222..234 440..467 552..566 603..625; |
less: no homolog appart from MP503; no idea from where the original annotation came; exp: RNA data from ZMBH, RNA-expressed; |
MP501 |
complement(623838..626063) |
| MPN336 |
complement(398358..399392) |
F10_orf291 |
g1674193 |
F10_orf291 |
new_conf, bidomain: nucleotidyl transferase and conserved hypo-thetical second domain, probably phosphopantetheine adenylyltransferase activity |
1-130 conserved archaeal/bacterial proteins with similarity to LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN and nucleotidyl transferases; 131-291 family of archaeal/bacterial proteins of unknown function |
  |
Fatty acid and phospholipid metabolism; phosphopantetheine adenylyltransferase (rate limiting step in CoA synthesis) ATP + pantetheine 4'phosphate <-> diphosphate + dephospho-Coenzyme A (CoA) |
MG240 |
  |
lc: 265..277; |
new_conf; N-terminal family of archaeal/bacterial proteins with similarity to nucleotidyl transferases and "LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS (exact function see below)" PROTEIN KDTB PSI-BLAST kdtb_ecoli 92250420 J. BACTERIOL. 174:3250-3260(1992); story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon; further support: common regulation of mRNA expression) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; Note: The operon is overall very similarly expressed, around 400 at 32 degrees, good exp. argument; cog1713 (given in the MG re-annotation update) is "Uncharacterized BCR"; however COG1057 (latest COG page) confirms the nucleotidyl transferase prediction. Exp. Data by Iszard and Geerlof (1999) EMBO show exact function of ktdb E.coli is phosphopantetheine adenylyltransferase; this could use the 4'phosphopantehteine created by the acyl carrier protein phospho diesterase (MP362). Participation in lipid metabolism via this CoA link |
MP500 |
622962..623837 |
| MPN337 |
399477..401342 |
F10_orf621 |
g1674192 |
F10_orf621 |
conserved hypothetical |
  |
  |
  |
MG241 |
MPN338 |
tm: 588..608; lc: 247..262 480..496; |
story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP499 |
complement(620853..622718) |
| MPN338 |
401345..403243 |
F10_orf632o |
g1674191 |
F10_orf632o |
conserved hypothetical |
  |
  |
  |
MG242 |
MPN337 |
tm: 571..591 603..623; cc: 322..355; |
story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP498 |
complement(618952..620850) |
| MPN339 |
403243..403917 |
H91_orf224 |
g1674190 |
H91_orf224 |
conserved hypothetical |
  |
  |
  |
  |
  |
sp: 1..47; tm: 54..74 108..128 153..173; |
story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP497 |
complement(618278..618952) |
| MPN340 |
403921..405510 |
pcrA |
g1674189 |
H91_orf529 |
conf,DNA helicase II |
  |
1PJR |
  |
  |
MPN341 |
tm: 506..526; |
less; Similar to previous one but without the C-terminal domain; Pfam:UvrD-helicase 5-469 exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP496 |
complement(616685..618274) |
| MPN341 |
405573..407720 |
mutB1 |
g1674187 |
H91_orf715 |
more__, DNA helicase II (with Mycoplasma specific C-terminal domain) |
1-620 similarity to DNA helicases II, PCRA_STAAU 94049679 Mol. Gen. Genet. 241 (1-2), 185-192 (1993); 640-728 uncharacterised C-terminal domain specific of MP, MG and the shorter UVRD_MYCCA 94075343 J. Biol. Chem. 268 (35), 26531-26540 (1993) |
1PJR |
  |
MG244 |
MPN340 |
cc: 575..599; lc: 680..692; |
Pfam:UvrD-helicase 10-488; exp PCRA_STAAU 94049679; better: E.coli 92358234 uvrD helicase II e-64 full protein, but story: this sequence has a domain specific of Mycoplasma which is not described, moreover the M capricolum protein has a different domain organization; annotation of UVRD_MYCCA could be wrong, it only matches part of DNA helicases II |
MP495 |
complement(614475..616622) |
| MPN342 |
407861..409492 |
hsdM |
g1674186 |
H91_orf543 |
conf, type I restriction enzyme HsdM |
  |
1YUB |
  |
  |
MPN352 |
  |
sub: type I restriction system; subunit M of type I restriction system; exp 89178628 T1M1_ECOLI |
MP494 |
complement(612703..614334) |
| MPN343 |
409871..410863 |
H91_orf330 |
g1674185 |
H91_orf330 |
conf,see: MP335 |
  |
  |
  |
  |
MPN089, MPN615, MPN567, MPN507, MPN365, MPN290, MPN289, MPN285, MPN201 |
lc: 46..111; |
family, see main representative MP335 |
MP493 |
complement(611332..612324) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN344 |
411086..411736 |
H91_orf216 |
g1674184 |
H91_orf216 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 173..215; lc: 66..93; |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP492 |
complement(610459..611109) |
| MPN345 |
412681..413301 |
hsdR |
g1674183 |
H91_orf206 |
conf,Type I Restriction Enzyme (fragment) |
  |
  |
  |
  |
  |
  |
MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 104-299 |
MP491 |
complement(608894..609514) |
| MPN346 |
413431..413778 |
H91_orf115 |
g1674182 |
H91_orf115 |
new, Type I Restriction Enzyme hsdR (fragment) |
  |
  |
  |
  |
  |
  |
new; MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 339-434; sub: type I restriction system; fragment of subunit R of the type I restriction system exp: RNA data from ZMBH, no expression, still hypothetical; |
MP490 |
complement(608417..608764) |
| MPN347 |
413985..415115 |
hsdR |
g1674181 |
H91_orf376 |
conf,Type I Restriction Enzyme (fragment) |
  |
  |
  |
  |
MPN398 |
cc: 152..184; lc: 279..291; |
MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 513-757; sub: type I restriction system; fragment of subunit R of the type I restriction system |
MP489 |
complement(607080..608210) |
| MPN348 |
416070..416564 |
H91_orf164 |
g1674179 |
H91_orf164 |
conf, 5-formyl tetrahydrofolate cyclo-ligase (HI0858) homolog; similar to GenBank Accession Number D64160, from H. influenzae |
  |
  |
Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; 5-formyl tetrahydrofolate cyclo-ligase; ATP + 5-formyltetrahydrofolate = ADP + P + 5,10-methenyltetrahydrofolate |
MG245 |
  |
  |
exp: RNA data from ZMBH, no expression, still hypothetical; |
MP488 |
complement(605631..606125) |
| MPN349 |
416554..417399 |
H91_orf281 |
g1674178 |
H91_orf281 |
conserved hypothetical |
  |
  |
  |
MG246 |
  |
  |
conserved family of bacterial hypothetical proteins exp: RNA data from ZMBH, RNA-expressed; suggestion STRING-server: Nucleotidase |
MP487 |
complement(604796..605641) |
| MPN350 |
complement(417391..418110) |
ygiH |
g1674177 |
H91_orf239 |
conserved hypothetical |
transmembrane (3?) |
  |
  |
MG247 |
MPN579 |
sp: 1..22; tm: 68..88 99..119 136..156 159..179 199..219; |
Conserved family of hypothetical proteins; Alignment shows 4 blocks of conservation separated by 3 hydrophobic (TM?) regions; Koonin says permease for MG homolog, I cannot see it; interesting ECOLI hypothetical prot homolog YGIH_ECOLI 205 aa and HI exp: RNA data from ZMBH, RNA-expressed; |
MP486 |
604085..604804 |
| MPN351 |
complement(418116..418757) |
H91_orf213 |
g1674176 |
H91_orf213 |
new_conf, methyltransferase |
10-53 matches to methyltransferase profile; rest no matches to functionally characterized proteins |
  |
  |
MG248 |
  |
  |
new_conf (Koonin); Closer is RRMA_ECOLI 98101475 J. BACTERIOL. 180:359-365(1998); psi-blast with 73-126 of RRMA_ECOLI hits MP485, inclusion of MP485 (Y248_MYCPN) in profile brings methyltranferases in; exp RRMA_ECOLI 98101475 |
MP485 |
603438..604079 |
| MPN352 |
complement(418741..420240) |
sigA |
g1674175 |
H91_orf499 |
less, Sigma-70 Factor Family |
1-240 No homolog appart of MG; 240-480 Sigma-70 Factor Family |
1SIG |
degraded by FtsH (?) |
MG249 |
  |
lc: 127..141; |
less original annotation could be overprediction; exp RPSA_BACSU (371 aa) J. BIOL. CHEM. 260:7178-7185(1985); Pfam:sigma70 246-480; sub: RNA polymerase |
MP484 |
601955..603454 |
| MPN353 |
complement(420293..422155) |
dnaE |
g1674174 |
H91_orf620 |
conf, DNA primase |
last 100 aa no homology appart of MG |
  |
  |
MG250 |
MPN014 |
lc: 437..453; |
Pfam:tRNA-synt_2b 58-430 |
MP483 |
600040..601902 |
| MPN354 |
complement(422139..423488) |
grs1 |
g1674173 |
H91_orf449 |
conf, glycyl-tRNA synthetase |
  |
1ATI-A |
  |
MG251 |
MPN553 |
  |
ok |
MP482 |
598707..600056 |
| MPN355 |
complement(423510..424238) |
yacO |
g1674172 |
H91_orf242a |
more_, tRNA/rRNA methyltransferase (fragment?) |
1-90 Has no homologs appart from MG; 90-242 tRNA/rRNA methyltransferase |
  |
  |
MG252 |
MPN521 |
  |
more_ tRNA/rRNA methyltransferases; Pfam:SpoU_methylase 95-238; large family of uncharacterized proteins except one: PT56_YEAST (421 aa); This one is matched only partially (MP481 has 242 aa) 89-237 to 235-405.; exp PT56_YEAST 86093663 NUCLEIC ACIDS RES. 13:8587-8601(1985) exp: RNA data from ZMBH, no expression, still hypothetical; |
MP481 |
597957..598685 |
| MPN356 |
complement(424241..425554) |
cysS |
g1674171 |
H91_orf437 |
conf, cysteinyl-tRNA synthetase |
  |
1GLN |
  |
MG253 |
  |
lc: 70..80 346..356; |
ok |
MP480 |
596641..597954 |
| MPN357 |
complement(425535..427511) |
lig |
g1674170 |
H91_orf658 |
conf, DNA ligase |
  |
  |
  |
MG254 |
  |
  |
conf,exp: RNA data from ZMBH, no expression, is hypothetical; (clear case for repeating expression measurements under a stress condition) |
MP479 |
594684..596660 |
| Gly-tRNA(GGC) |
complement(427575..427647) |
mptgg |
  |
  |
Is mptgg correct? See Trp-tRNA(TGG) above. |
  |
  |
  |
  |
  |
  |
  |
complement(427575..427647) |
594548..594620 |
| MPN358 |
427679..429283 |
H91_orf534 |
g1674169 |
H91_orf534 |
conserved hypothetical |
  |
  |
  |
MG255; MG255.1 |
  |
tm: 182..202; lc: 104..123 150..162; |
conf,exp: RNA data from ZMBH, RNA-expressed; |
MP478 |
complement(592912..594516) |
| Trp-tRNA(TGG) |
429432..429505 |
mptgg |
  |
  |
Is mptgg correct? See Gly-tRNA(GGC) below. |
  |
  |
  |
  |
  |
  |
  |
429432..429505 |
complement(592690..592763) |
| MPN359 |
429513..430289 |
H91_orf258 |
g1674168 |
H91_orf258 |
conserved hypothetical |
  |
  |
  |
MG256 |
  |
tm: 41..61 72..92; |
only MG and MP exp: RNA data from ZMBH, RNA-expressed; |
MP477 |
complement(591906..592682) |
| MPN360 |
430334..430627 |
rpmE |
g1674167 |
H91_orf97 |
conf, ribosomal protein L31 |
  |
  |
  |
MG257 |
  |
  |
SUB; sub: ribosomal |
MP476 |
complement(591568..591861) |
| MPN361 |
430628..431707 |
prfA |
g1674166 |
H91_orf359V |
conf, peptide chain release factor 1 |
  |
  |
  |
MG258 |
  |
cc: 59..102; |
ok |
MP475 |
complement(590488..591567) |
| MPN362 |
431707..433068 |
H91_orf453 |
g1674165 |
H91_orf453 |
new, hemk family, similar to methyltransferase (S-adenosyl-methionine dependent) |
66-254 similar to N-6 Adenine-specific DNA methylase |
1AQI-A |
intermediay metabolism; methyltransferase (perhaps for adenine ?) |
MG259 |
  |
lc: 140..155; |
N-terminal half (till aa 217) domain (I checked that the low cplx region inbetween is contained) is clear member of the hemK family (psi-blast, directly, e-11, many members) protoporphyrinogen oxidase is not confirmed biochemically. This is a protein of the hemK family, but new biochemical data show now clearly no (!) involvment in porphyrine synthesis, instead by sequence similarity S-adenosyl-methionine-dependent methyltransferase suggested. PMID: 10220893, UI: 99237242. N-6 adenine specific DNA methyltransferase is both similar in sequence and structure. The C-terminus is conserved hypothetical (MG,MP, Thermotoga maritima; converged) exp: RNA data from ZMBH, only once 32 degrees, low; |
MP474 |
complement(589127..590488) |
| MPN363 |
433200..433508 |
H91_orf102 |
g1674164 |
H91_orf102 |
see: MP631 conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN146, MPN097, MPN506, MPN408, MPN336, MPN288, MPN284, MPN281, MPN200, MPN199 |
sp: 1..27; |
see comments to MP631. |
MP473 |
complement(588687..588995) |
| MPN364 |
433547..435580 |
H91_orf677 |
g1674163 |
H91_orf677 |
see: MP631 conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 |
lc: 110..137 361..389; |
see comments to MP631. |
MP472 |
complement(586615..588648) |
| MPN365 |
435924..436730 |
H91_orf268 |
g1674161 |
H91_orf268 |
conf,see: MP335 |
  |
  |
  |
  |
MPN089, MPN615, MPN507, MPN343, MPN290, MPN289, MPN285, MPN201 |
  |
family, see main representative MP335 |
MP471 |
complement(585465..586271) |
| MPN366 |
436814..437632 |
H91_orf272 |
g1674160 |
H91_orf272 |
new_conf, see: MP012 involved in cytadherence |
  |
  |
  |
  |
MPN149, MPN142, MPN503 |
lc: 43..58 72..88 222..237; |
exp: RNA data from ZMBH, RNA-expressed; |
MP470 |
complement(584563..585381) |
| MPN367 |
437563..438531 |
H91_orf322 |
g1674159 |
H91_orf322 |
new_conf, see: MP012 involved in cytadherence |
  |
  |
  |
  |
MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN464, MPN414 |
lc: 3..30 244..257; |
exp: RNA data from ZMBH, RNA-expressed; |
MP469 |
complement(583664..584632) |
| MPN368 |
439220..439762 |
H91_orf180 |
g1674158 |
H91_orf180 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 69..122; |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP468 |
complement(582433..582975) |
| MPN369 |
complement(439894..440655) |
H91_orf253 |
g1674157 |
H91_orf253 |
see: MP199, conserved hypothetical |
  |
  |
  |
  |
MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN271 |
sp: 1..31; |
  |
MP467 |
581540..582301 |
| MPN370 |
441296..443509 |
A19_orf737V |
g1674156 |
A19_orf737V |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN131, MPN101, MPN099, MPN502, MPN500, MPN468, MPN409, MPN286, MPN205, MPN202 |
sp: 1..20; tm: 590..610; lc: 59..76 93..105 146..163 421..435 461..474 536..548; |
  |
MP466 |
complement(578686..580899) |
| MPN371 |
complement(443552..444187) |
A19_orf211 |
g1674155 |
A19_orf211 |
hypothetical |
  |
  |
  |
  |
  |
lc: 122..135; |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP465 |
578008..578643 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN372 |
444341..446116 |
A19_orf591 |
g1674154 |
A19_orf591 |
new, similarity to pertussis toxin subunit s1 |
1-240 similar to pertussis toxin subunit s1 (270 aa) |
1BCP-A |
  |
  |
  |
  |
new; no pfam; sub: pertussis toxin |
MP464 |
complement(576079..577854) |
| MPN373 |
complement(446127..446741) |
A19_orf204 |
g1674153 |
A19_orf204 |
hypothetical see: MP460 |
  |
  |
  |
  |
MPN376 |
lc: 158..176; |
similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed; |
MP463 |
575454..576068 |
| MPN374 |
complement(447770..448459) |
A19_orf229V |
g1674151 |
A19_orf229V |
hypothetical see: MP460 |
  |
  |
  |
  |
MPN376 |
cc: 73..106; |
similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed; |
MP462 |
573736..574425 |
| MPN375 |
complement(448805..449194) |
A19_orf129 |
g1674150 |
A19_orf129 |
hypothetical see: MP460 |
  |
  |
  |
  |
MPN376 |
  |
similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed; |
MP461 |
573001..573390 |
| MPN376 |
complement(449573..452995) |
A19_orf1140 |
g1674149 |
A19_orf1140 |
hypothetical |
  |
  |
  |
  |
MPN375, MPN374, MPN373 |
sp: 1..26; lc: 272..284; |
No homology out of MP; MP461, MP462 and MP463 are similar to consecutive parts of this one; URF exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH TX-UF, Ges. auf Gel bei ca. 12kD (N-term.) Gel 157 bei ca. 31kD in bas. Rand; |
MP460 |
569200..572622 |
| Arg-tRNA(CGA) |
complement(453260..453334) |
mptga |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(453260..453334) |
568861..568935 |
| MPN377 |
453422..453646 |
  |
A19_orf74 |
A19_orf74 |
hypothetical |
  |
  |
  |
  |
  |
  |
  |
MPN377 |
complement(568549..568773) |
| MPN378 |
453650..456268 |
dnaE |
g1674148 |
A19_orf872 |
conf, DNA polymerase III alpha subunit |
1-100 DP3A_ECOLI PSI-BLAST iter-3 Identities = 29/101 (28%) J. Bacteriol. 169 (12), 5735-5744 (1987); 100-260 exclusive of DP3A_MYCPN DP3A_MYCGE; 260-780 DP3A_ECOLI FASTA 34.7% identities, length = 574; 780-872 unique of DP3A_MYCPN DP3A_MYCGE |
  |
  |
MG261 |
MPN034 |
lc: 157..163; |
story It has a different domain organization than other DP3As; No PFAM; Note the different domain organization; exp DP3A_ECOLI 88058791; DP3A_ECOLI has domains not present in this one!; sub: DNA polimerase III |
MP459 |
complement(565927..568545) |
| MPN379 |
456272..457147 |
polA |
g1674147 |
A19_orf291 |
less, 5'-3' exonuclease (complete) |
  |
1BGX-T |
  |
MG262 |
MPN658 |
  |
less It is not a fragment of a DNA polymerase I but a complete 5'-3' exonuclease; PF01367 5_3_exonuclease; exp EX9_ECOLI 98256427 NUCLEIC ACIDS RES. 26:2593-2597(1998) 26.2% identities, length = 221 SwissProt annot CONF,but gene name still polA exp: RNA data from ZMBH only once at 32 degrees, doubtful; |
MP458 |
complement(565048..565923) |
| MPN380 |
457147..457980 |
fpg |
g1674146 |
A19_orf277 |
conf, formamidopyrimidine-DNA glycosylase |
  |
  |
  |
MG262.1 |
  |
  |
PF01149 Formamidopyrimidine-DNA glycosylase; exp FPG_LACLC 37.1% identities, length = 275 MICROBIOLOGY 141:411-417(1995) |
MP457 |
complement(564215..565048) |
| MPN381 |
458126..459004 |
yidA |
g1674144 |
A19_orf292 |
new_conf, HAD superfamily hydrolase/phosphatase |
  |
  |
  |
MG263 |
MPN383 |
  |
new_conf Koonin; PFAM DUF3 exp: RNA data from ZMBH, RNA-expressed; |
MP456 |
complement(563191..564069) |
| MPN382 |
458998..459600 |
A19_orf200 |
g1674143 |
A19_orf200 |
conserved hypothetical |
  |
  |
  |
MG264 |
  |
  |
hypothetical family; Pfam:UPF0038 exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP455 |
complement(562595..563197) |
| MPN383 |
complement(459530..460378) |
yidA |
g1674142 |
A19_orf282 |
new_conf, HAD superfamily hydrolase/phosphatase |
  |
  |
  |
MG265 |
MPN427, MPN381, MPN264 |
  |
new_conf Koonin; alignment PFAM DUF3 bacterial domain of unknown function exp: RNA data from ZMBH, RNA-expressed; |
MP454 |
561817..562665 |
| MPN384 |
complement(460381..462762) |
leuS |
g1674141 |
F11_orf793o |
conf, leucyl-tRNA synthetase |
  |
  |
  |
MG266 |
MPN023, MPN520, MPN480 |
  |
  |
MP453 |
559433..561814 |
| MPN385 |
complement(462763..463107) |
F11_orf114 |
g1674140 |
F11_orf114 |
conserved hypothetical |
  |
  |
  |
MG267 |
  |
sp: 1..19; tm: 76..96; |
MP MG specific exp: RNA data from ZMBH, RNA-expressed; |
MP452 |
559088..559432 |
| MPN386 |
complement(463142..463831) |
yaaF |
g1674139 |
F11_orf229 |
more__, DEOXYGUANOSINE KINASE/ DEOXYADENOSINE KINASE |
  |
1UKY |
  |
MG268 |
  |
lc: 47..60; |
new_add: 2.7.1.113. The molecular function on the left is more specific than Sternberg nucleotide kinase and than genebankMG cons hyp exp: RNA data from ZMBH, RNA-expressed; |
MP451 |
558364..559053 |
| 4.5S_RNA |
complement(463876..463954) |
No info |
  |
  |
S76009 has more 5'-34 and 3'-21 residues comparing to ZMBH www page, but scRNA corresponds to 35-113 of S76009. Then the length is the same as ZMBH. There is one mismatch between the selected region in the genome sequence and S76009. |
  |
  |
  |
  |
  |
  |
  |
complement(463876..463954) |
558241..558319 |
| MPN387 |
complement(463979..465055) |
F11_orf358b |
g1674138 |
F11_orf358b |
conserved hypothetical |
  |
  |
  |
MG269 |
MPN399, MPN310 |
cc: 87..273; |
coiled coil exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, TX-UF, Ges. |
MP450 |
557140..558216 |
| MPN388 |
complement(465048..465434) |
  |
New identified |
New identified |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
  |
449-450 |
557019..557147 |
| MPN389 |
complement(465427..466446) |
lplA |
g1674137 |
F11_orf339 |
conf, lipoate protein ligase |
  |
  |
  |
MG270 |
  |
  |
  |
MP449 |
555749..556768 |
| MPN390 |
complement(466473..467846) |
pdhD |
g1674136 |
F11_orf457 |
conf, dihydrolipoamide dehydrogenase |
  |
1LPF-A |
Energy metabolism, Pyruvate dehydrogenase; dihydrolipoamide dehydrogenase (pdhD); Dihydrolipoamide + NAD(+) = lipoamide + NADH ; |
MG271 |
MPN051, MPN557, MPN394, MPN240 |
lc: 86..98 175..184; |
dihydrolipoamide dehydrogenase |
MP448 |
554349..555722 |
| MPN391 |
complement(467847..469055) |
pdhC |
g1674135 |
F11_orf402 |
conf, dihydrolipoamide acetyltransferase component (E2) |
  |
1E2O, 1IYU |
Energy metabolism, Pyruvate dehydrogenase; dihydrolipoamide acetyltransferase component (E2); Acetyl-CoA + dihydrolipoamide = CoA + S-acetyldihydrolipoamide; |
MG272 |
MPN119, MPN452 |
lc: 80..118 138..170; |
dihydrolipoamide acetyltransferase component (E2) |
MP447 |
553140..554348 |
| MP200_RNA |
complement(469102..469312) |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(469102..469312) |
552883..553093 |
| MPN392 |
complement(469374..470357) |
pdhB |
g1674134 |
F11_orf327 |
conf, pyruvate dehydrogenase E1-beta subunit |
  |
1AY0-A |
Energy metabolism, Pyruvate dehydrogenase; pyruvate dehydrogenase E1-beta subunit (pdhB); pyruvate + lipoamide = S-acetyldihydrolipoamide + CO2 (with the alpha subunit only) |
MG273 |
  |
lc: 61..77; |
E1-beta subunit sub |
MP446 |
551838..552821 |
| MPN393 |
complement(470379..471455) |
pdhA |
g1674133 |
F11_orf358a |
conf, Pyruvate dehydrogenase |
  |
1AY0-A |
Energy metabolism, Pyruvate dehydrogenase; pyruvate dehydrogenase E1-alpha subunit (pdhA); pyruvate + lipoamide = S-acetyldihydrolipoamide + CO2; (with the beta subunit only note: no accident, the NADH oxidase MP444 so close to the pyruvate dehydrogenase; sense/ story ? |
MG274 |
MPN082 |
  |
E1-alpha subunit sub |
MP445 |
550740..551816 |
| MPN394 |
complement(471476..472915) |
nox |
g1674132 |
F11_orf479 |
conf, NADH oxidase |
  |
1BHY |
Energy metabolism, Aerobic; NADH oxidase (nox); NADH + H(2)O(2) = NAD + 2 H2O ; hemolysin; pathogenicity factor; |
MG275 |
MPN390 |
  |
  |
MP444 |
549280..550719 |
| MPN395 |
complement(472983..473516) |
apt |
g1674131 |
F11_orf133 |
conf, adenine phosphoribosyltransferase |
  |
1A3C |
Nucleotide and deoxynucleotide degradation or rescue reaction. adenine phosphoribosyltransferase; AMP + pyrrophosphate = Adenine + phosphoribosylpyrrophosphate. |
MG276 |
MPN073 |
  |
extend gene to 5' GTG start conf,Mikita found this N-terminal extension, so in fact MKQKLQALDRAIKRFNDFPTPGILFYDITPIFLNSELFEFVLEQ before MAQFIQEVKADGIVCP..., but Bairoch (P75388) not; Richard Hermann SEES this N-terminal extension also in his gels. |
MP443 |
548811..549212 |
| MPN396 |
complement(473551..476466) |
F11_orf887 |
g1674129 |
F11_orf887 |
new, protein export, secD like |
  |
  |
  |
MG277 |
  |
tm: 432..452 462..482 485..505 534..554 572..592 641..661 678..698 706..726 735..755 793..813 817..837; lc: 66..80 292..307; |
secD-like domain in the protein; homologous in psi-blast to B.subtilis secDF (fusion); however, further analysis shows that the secD domain of B.subtilis finds MP442 back in psi-blast significantly (2nd iteration, e-37) and that these are definitely at least secD-like domains. Confirming evidence is available from the strings neighbourhood server (note that there is one big family with secD and F fused in addition to understand better strings server output). Detailed sequence alignment shows clear homology to secD family, but again that the domain is only secD-like. |
MP442 |
545981..548644 |
| MPN397 |
476470..478671 |
spoT |
g1674128 |
F11_orf733 |
more__, p)ppGpp 3'-pyrophosphohydrolase |
  |
  |
regulatory function |
MG278 |
  |
cc: 508..530; lc: 489..501; |
story: produces ppGpp, mediator for stringent response which binds to the beta subunit of the RNA polymerase (MP236) inhibiting transcription, and in E. coli (98190325) activates the PHO regulon related to phosphate transport - It could do the same in MP with operon MP231-234 |
MP441 |
complement(543524..545725) |
| MPN398 |
complement(478668..479324) |
F11_orf218 |
g1674127 |
F11_orf218 |
conserved hypothetical |
  |
  |
  |
MG279 |
  |
sp: 1..26; tm: 160..180; |
exp: RNA data from ZMBH, RNA-expressed; |
MP440 |
542871..543527 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN399 |
complement(479324..480187) |
F11_orf287 |
g1674126 |
F11_orf287 |
conserved hypothetical |
  |
  |
  |
MG280 |
MPN387 |
sp: 1..30; tm: 226..246; cc: 68..144; |
exp: RNA data from ZMBH, RNA-expressed; |
MP439 |
542008..542871 |
| MPN400 |
complement(480249..481997) |
F11_orf582 |
g1674125 |
F11_orf582 |
conserved hypothetical |
  |
  |
  |
MG281 |
  |
lc: 6..18; |
exp: RNA data from ZMBH, RNA-expressed; |
MP438 |
540198..541946 |
| Gly-tRNA(GGA) |
complement(482285..482358) |
  |
  |
  |
In Genbank, "gene" missing. Maybe gene = "mptrna" |
  |
  |
  |
  |
  |
  |
  |
complement(482285..482358) |
539837..539910 |
| Leu-tRNA(TTA) |
complement(482365..482450) |
mptrna |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(482365..482450) |
539745..539830 |
| Lys-tRNA(AAA) |
complement(482451..482525) |
mptrna |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(482451..482525) |
539670..539744 |
| Gln-tRNA(CAA) |
complement(482569..482643) |
mptrna |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(482569..482643) |
539552..539626 |
| Tyr-tRNA(TAC) |
complement(482649..482735) |
mptrna |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(482649..482735) |
539460..539546 |
| MPN401 |
complement(482765..483247) |
greA |
g1674124 |
F11_orf160 |
conf, transcription elongation factor |
  |
1GRJ |
  |
MG282 |
  |
  |
  |
MP437 |
538948..539430 |
| MPN402 |
483529..484980 |
proS |
g1674123 |
F11_orf483 |
conf, putative prolyl-tRNA synthetase; similar to Swiss-Prot Accession Number P38708, from S. cerevisiae |
  |
1ATI-A |
  |
MG283 |
  |
lc: 403..415; |
  |
MP436 |
complement(537215..538666) |
| MPN403 |
485125..485493 |
F11_orf122a |
g1674121 |
F11_orf122a |
conserved hypothetical |
  |
  |
  |
MG284 |
  |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP435 |
complement(536702..537070) |
| MPN404 |
485474..486514 |
F11_orf346 |
g1674120 |
F11_orf346 |
conserved hypothetical |
  |
  |
  |
MG285 |
  |
lc: 219..228; |
MG MP specific exp: RNA data from ZMBH, RNA-expressed; |
MP434 |
complement(535681..536721) |
| MPN405 |
486521..487114 |
F11_orf197 |
g1674119 |
F11_orf197 |
conserved hypothetical |
  |
  |
  |
MG286 |
  |
sp: 1..26; |
MG MP specific exp: RNA data from ZMBH, RNA-expressed; |
MP433 |
complement(535081..535674) |
| MPN406 |
487149..487403 |
F11_orf84 |
g1674118 |
F11_orf84 |
conf, acyl carrier protein homolog; similar to GenBank Accession Number L43074_3, from S. glaucescens |
  |
  |
Fatty acid and phospholipid metabolism; acyl carrier protein; |
MG287 |
  |
  |
  |
MP432 |
complement(534792..535046) |
| Trp-tRNA(TGA) |
487394..487468 |
mptgwa |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
487394..487468 |
complement(534727..534801) |
| MPN407 |
complement(487508..490147) |
F11_orf879 |
g1674117 |
F11_orf879 |
new, lipase |
Lipase_GDSL: 540-624 |
  |
  |
  |
  |
sp: 1..36; |
exported, Lipase_GDSL domain (PFAM 1.5 E-3 score for a Lipase GDSL domain) , new |
MP431 |
532048..534687 |
| MPN408 |
490375..492657 |
F11_orf760 |
g1674116 |
F11_orf760 |
see: MP631, conserved hypothetical |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 |
sp: 1..28; |
see comments to MP631. exp: 2D-Gel data from ZMBH, TX-UF, auf Gel mw ca. 25kD, IEP 6.7; |
MP430 |
complement(529538..531820) |
| MPN409 |
492730..494331 |
F11_orf533L |
g1674115 |
F11_orf533L |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN370, MPN286, MPN203, MPN202 |
lc: 28..45 66..76 111..127 390..402 425..437 452..463; |
  |
MP429 |
complement(527864..529465) |
| MPN410 |
494694..495140 |
F11_orf148o |
g1674114 |
F11_orf148o |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
  |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP428 |
complement(527055..527501) |
| MPN411 |
complement(495282..496040) |
A05_orf252 |
g1674113 |
A05_orf252 |
see: MP199; conserved hypothetical |
  |
  |
  |
  |
MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN369, MPN271 |
sp: 1..31; |
  |
MP427 |
526155..526913 |
| MPN412 |
496634..497470 |
  |
A05_orf278 |
A05_orf278 |
not in Genbank, but in the ZMBH list |
  |
  |
  |
  |
  |
  |
  |
426.2 |
complement(524725..525561) |
| MPN413 |
497547..497966 |
  |
A05_orf139 |
A05_orf139 |
not in Genbank, but in the ZMBH list |
  |
  |
  |
  |
  |
  |
  |
426.1 |
complement(524229..524648) |
| MPN414 |
498076..499557 |
A05_orf493 |
g1674111 |
A05_orf493 |
see: MP012, new_conf, involved in cytadherence |
  |
  |
  |
  |
MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN468, MPN464, MPN367 |
lc: 44..61 252..265; |
exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP426 |
complement(522638..524119) |
| MPN415 |
499808..500950 |
P37 |
g1674110 |
A05_orf380V |
conf, high affinity transport system protein P37 |
  |
  |
Transporter, ABC superfamily; function ? |
MG289 |
  |
sp: 1..30; |
  |
MP425 |
complement(521245..522387) |
| MPN416 |
500943..501677 |
P29 |
g1674109 |
A05_orf244 |
conf, ATP-binding protein P29 |
  |
  |
Transporter, ABC superfamily; function ? |
MG290 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
  |
  |
MP424 |
complement(520518..521252) |
| MPN417 |
501670..503298 |
P69 |
g1674108 |
A05_orf542 |
conf, transport system permease protein P69 |
  |
  |
Transporter, ABC superfamily; function ? |
MG291 |
  |
sp: 1..42; tm: 76..96 113..133 137..157 208..228 234..254 286..306 351..371 410..430 509..529; lc: 373..394 484..500; |
  |
MP423 |
complement(518897..520525) |
| MPN418 |
complement(503299..503721) |
  |
New identified |
New identified |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
  |
422-423 |
518474..518896 |
| MPN419 |
complement(503721..506423) |
alaS |
g1674107 |
A05_orf900 |
conf, alanyl-tRNA synthetase |
  |
  |
  |
MG292 |
  |
lc: 313..331 616..632 872..886; |
  |
MP422 |
515772..518474 |
| MPN420 |
complement(506475..507200) |
glpQ |
g1674106 |
A05_orf241a |
conf, glycerophosphoryl diester phosphodiesterase |
  |
  |
Central intermediary metabolism; Other; glycerophosphoryl diester phosphodiesterase (glpQ); glycerophosphodiester + H2O = an alcohol + sn-glycerol 3-phosphate; |
MG293 |
MPN566 |
  |
  |
MP421 |
514995..515720 |
| MPN421 |
complement(507193..508620) |
A05_orf475 |
g1674105 |
A05_orf475 |
conf, permease |
  |
  |
Transporter, MFS type; |
MG294 |
MPN113, MPN112 |
tm: 18..38 58..78 88..108 121..141 165..185 201..221 253..273 277..297 319..339 350..370 434..454; |
annotated already for MG |
MP420 |
513575..515002 |
| MPN422 |
complement(508751..509863) |
A05_orf370 |
g1674103 |
A05_orf370 |
new_conf, TRNA (5-METHYLAMINOMETHYL-2-THIOURIDYLATE)-METHYLTRANSFERASE. |
  |
1GPM-A |
  |
MG295 |
MPN562 |
  |
new_conf: Is not in genebank, also not in genbankMG (cons hyp); N-type pyrrophosphatase by Sternberg, but as tRNA methyltransferase in Swissprot; exp: RNA data from ZMBH, 32 degrees, RNA-expressed |
MP419 |
512332..513444 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN423 |
complement(509864..510253) |
A05_orf129 |
g1674102 |
A05_orf129 |
conserved hypothetical |
  |
  |
  |
MG296 |
  |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP418 |
511942..512331 |
| MPN424 |
complement(510253..510561) |
ylxM |
g1674101 |
A05_orf102 |
conserved hypothetical |
  |
  |
  |
  |
  |
lc: 72..85; |
DNA binding ? conserved gene order vs. B.subtilis MP416-MP417 BS1595-1597 exp: RNA data from ZMBH, no expression, is hypothetical ! |
MP417 |
511634..511942 |
| MPN425 |
complement(510542..511588) |
ftsY |
g1674100 |
A05_orf348 |
conf, cell division protein FtsY |
  |
1FTS |
  |
MG297 |
MPN061 |
  |
  |
MP416 |
510607..511653 |
| MPN426 |
complement(511594..514542) |
A05_orf982 |
g1674099A |
A05_orf982 |
new, SMC family, chromosome/DNA binding/protecting functions |
  |
  |
  |
MG298 |
  |
cc: 171..226 263..319 567..646 782..817; |
less: P115 is a misleading descriptor (there is a golgi associated - eukaryotic - P115 protein); smc family is present in archaea bacteria and eukarya; exp: _SUBTI 98417635; Structural maintenance of chromosomes (SMC) proteins function in chromosome condensation and several other aspects of DNA processing.They are large proteins characterized by an NH2-terminal nucleotide triphosphate (NTP)-binding domain, two long segments of coiled coil separated by a hinge, and a COOH-terminal domain. In UI91138990 / JQ0894 the authors desribe only the ATP/GTP binding motif and exp cytoplasmic localization |
MP415 |
507653..510601 |
| MPN427 |
514727..515599 |
yidA |
g1674098 |
A05_orf290 |
new, hydrolase/phosphatase |
DUF3 (PFAM) |
  |
  |
  |
MPN383, MPN264 |
  |
new exp: RNA data from ZMBH, RNA-expressed; |
MP414 |
complement(506596..507468) |
| MPN428 |
complement(515605..516567) |
pta |
g1674097 |
A05_orf320 |
conf, phosphotransacetylase |
  |
  |
Central intermediary metabolism, Other; phosphotransacetylase (pta); note: [Phosphate acetyltransferase Phosphoacylase] also acts with other short-chain acyl-CoA's. AcetylCoA + P = CoA + acetyl-phosphate; |
MG299 |
  |
  |
MP411, 412, 413 linking glycolysis to anaerobic acetate production |
MP413 |
505628..506590 |
| MPN429 |
complement(516605..517834) |
pgk |
g1674096 |
A05_orf409 |
conf, phosphoglycerate kinase |
  |
1PHP |
Energy metabolism, Glycolysis; phosphoglycerate kinase (pgk); 3-phospho-D-glycerate + ATP = ADP + 3-phospho-D-glyceroyl phosphate; |
MG300 |
MPN026 |
  |
  |
MP412 |
504361..505590 |
| MPN430 |
complement(517837..518850) |
gap |
g1674095 |
A05_orf337 |
conf, glycerladehyde-3-phosphate dehydrogenase |
  |
1GAD-O |
Energy metabolism, Glycolysis; glyceraldehyde-3-phosphate dehydrogenase(gap); D-glyceraldehyde 3-phosphate + phosphate + NAD(+)= 3-phospho-D-glyceroyl phosphate + NADH; |
MG301 |
  |
  |
  |
MP411 |
503345..504358 |
| MPN431 |
complement(518881..519834) |
A05_orf317 |
g1674094 |
A05_orf317 |
new_conf, permease |
  |
  |
Transporter, ABC superfamily; subunit of unknown transporter, perhaps involved in cobalt or cobolamin transport; |
MG302 |
MPN195 |
sp: 1..34; tm: 53..73 124..144 253..273; |
new_conf; J. Bacteriol. 175 (11), 3303-3316 (1993) cobalt ? cobalt permease and related tranpsorters also by COG619 |
MP410 |
502361..503314 |
| MPN432 |
complement(519824..520972) |
artP |
g1674093 |
A05_orf382 |
conf, abc transport ATP-binding protein |
  |
  |
Transporter, ABC superfamily; subunit of unknown transporter, perhaps involved in cobalt or cobolamin transport; |
MG303 |
MPN134, MPN081, MPN055, MPN685, MPN683, MPN609, MPN433, MPN416, MPN258, MPN218, MPN217, MPN194, MPN193 |
lc: 278..290; |
cobalt ? Mikita sees an overlap with MP408 of 106 bp.s; Bairoch has the start (P75356) at MQTPQIIWSLIAPQYRGLAN ... so 29 AA shorter (but not 35 Aa), which reduces the overlap; |
MP409 |
501223..502371 |
| MPN433 |
complement(520867..521679) |
cbiO |
g1674092 |
A05_orf270L |
conf, abc transport ATP-binding protein |
  |
  |
Transporter, ABC superfamily; subunit of unknown transporter, perhaps involved in cobalt or cobolamin transport; |
MG304 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN432, MPN416, MPN334, MPN258, MPN218, MPN194, MPN193 |
  |
cobalt ? |
MP408 |
500516..501328 |
| MPN434 |
complement(521837..523624) |
dnaK |
g1674090 |
A05_orf595 |
conf, dnaK |
  |
1ATR, 1DKX-A |
Chaperon; activated by DnaJ |
MG305 |
  |
cc: 230..261 499..518; |
sub:hsp70 with dnaJ (MP133) and grpE (MP034) |
MP407 |
498571..500358 |
| MPN435 |
complement(523680..524867) |
A05_orf395 |
g1674089 |
A05_orf395 |
new, permease |
  |
  |
  |
MG306 |
  |
sp: 1..42; tm: 56..76 92..112 139..159 176..196 254..274 345..365; |
new, by sequence similarity; cons hyp by Sternberg and GenbankMG;swissprot and COG392 say just integral membrane protein; |
MP406 |
497328..498515 |
| MPN436 |
complement(524877..528611) |
A05_orf1244 |
g1674088 |
A05_orf1244 |
more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium |
  |
  |
  |
MG307 |
MPN489, MPN485, MPN444, MPN442, MPN440, MPN439, MPN438, MPN437 |
sp: 1..34; lc: 441..453 478..491 548..564; |
see also MP 353, this is clearly a Mollicute specific lipoprotein |
MP405 |
493584..497318 |
| MPN437 |
complement(528920..530638) |
H08_orf572o |
g1674087 |
H08_orf572o |
see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium |
  |
  |
  |
  |
MPN489, MPN444, MPN440, MPN436 |
lc: 192..208 364..376; |
  |
MP404 |
491557..493275 |
| MPN438 |
complement(530856..531893) |
H08_orf345 |
g1674086 |
H08_orf345 |
see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium |
  |
  |
  |
  |
MPN440, MPN436 |
lc: 28..48 236..251 299..332; |
  |
MP403 |
490302..491339 |
| MPN439 |
complement(531949..532662) |
H08_orf237 |
g1674085 |
H08_orf237 |
see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium |
  |
  |
  |
  |
MPN489, MPN444, MPN442, MPN436 |
sp: 1..29; |
  |
MP402 |
489533..490246 |
| MPN440 |
complement(532818..534998) |
H08_orf726 |
g1674084 |
H08_orf726 |
see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium |
  |
  |
  |
  |
MPN489, MPN444, MPN438, MPN437, MPN436 |
lc: 39..50 329..342 373..387 501..514 667..678; |
  |
MP401 |
487197..489377 |
| MPN441 |
535468..535776 |
H08_orf102 |
g1674083 |
H08_orf102 |
conserved hypothetical |
  |
  |
  |
  |
  |
tm: 52..72; |
exp: RNA data from ZMBH, once at 32 degree, doubtful; |
MP400 |
complement(486419..486727) |
| MPN442 |
complement(536089..536541) |
H08_orf150 |
g1674081 |
H08_orf150 |
more__, species specific lipoprotein |
  |
  |
  |
  |
MPN444, MPN439, MPN436 |
sp: 1..29; |
new_add (see MP353) |
MP399 |
485654..486106 |
| MPN443 |
complement(536526..537755) |
deaD |
g1674080 |
H08_orf409 |
conf, RNA helicase, eIF4-A translation initiation factor |
  |
1A1V-A |
  |
MG308 |
MPN623, MPN211 |
  |
  |
MP398 |
484440..485669 |
| MPN444 |
complement(537762..541739) |
H08_orf1325 |
g1674079 |
H08_orf1325 |
conserved hypothetical |
  |
  |
  |
MG309 |
MPN489, MPN485, MPN442, MPN440, MPN439, MPN437, MPN436, MPN333 |
sp: 1..29; cc: 691..719; lc: 436..465 918..932 993..1014 1273..1285; |
Avian Dis. 35 (1), 62-69 (1991) exp: RNA data from ZMBH, RNA-expressed; |
MP397 |
480456..484433 |
| MPN445 |
541734..542603 |
lip3 |
g1674078 |
H08_orf289 |
conf, triacylglycerol lipase (lip) 3 |
  |
1BE0 |
Fatty acid and phospholipid metabolism; triacylglycerol lipase; Triacylglycerol + H2O = diacylglycerol + a fatty acid anion. |
MG310 |
MPN519, MPN473 |
  |
Gene 158 (1), 107-111 (1995); Mikita sees good intergenic region; Bairoch: Real start at MRLEIENGLEFVCDPFLNE... the fist 20 aa are not real. |
MP396 |
complement(479592..480461) |
| MPN446 |
complement(542664..543281) |
rpsD |
g1674077 |
H08_orf205 |
conf, ribosomal protein S4 |
  |
  |
  |
MG311 |
  |
SUB ribosomal |
SUB; putative HMW cytadherence operon (promotor localization and terminator sequences, lack of Shine-Dalgarno sequences in most of the ORFs in this putative operon; Krause,D. Mol.Microbiology 1996; 20, 247-253. |
MP395 |
478914..479531 |
| MPN447 |
complement(543304..546360) |
hmw1 |
g1674076 |
H08_orf1018 |
conf, cytadherence accessory protein HMW1 |
105-140 domain present in MP035 and MP275 |
  |
  |
MG312 |
MPN119, MPN687, MPN567, MPN474, MPN452, MPN154 |
cc: 782..816 849..879; lc: 211..229 331..344 347..363 391..415 426..466 468..482 553..569; |
story: contains a domain, exclusive to MP/MG, common to another cytadherence protein and to a protein with probable cochaperone activity putative HMW cytadherence operon; HMW1; |
MP394 |
475835..478891 |
| MPN448 |
complement(546424..547281) |
H08_orf263 |
g1674075 |
H08_orf263 |
conserved hypothetical |
  |
  |
  |
MG313 |
  |
sp: 1..43; tm: 56..76 96..116 138..158 175..195; |
exp: RNA data from ZMBH, RNA-expressed; putative HMW cytadherence operon; P33 |
MP393 |
474980..475771 |
| MPN449 |
complement(547332..548678) |
orf8 |
g1674073 |
H08_orf448 |
conserved hypothetical |
  |
  |
  |
MG314 |
  |
tm: 202..222 267..287 328..348 386..406; |
putative HMW cytadherence operon; P50; |
MP392 |
473517..474863 |
| MPN450 |
complement(548690..549634) |
orf7 |
g1674072 |
H08_orf314 |
conserved hypothetical |
  |
  |
  |
MG315 |
  |
sp: 1..21; lc: 229..241; |
exp: RNA data from ZMBH, RNA-expressed; putative HMW cytadherence operon; P36; |
MP391 |
472561..473505 |
| MPN451 |
complement(549513..550622) |
come3 |
g1674071 |
H08_orf369 |
conf, competence locus operon protein 3 homolog; similar to Swiss-Prot Accession Number P39695, from B. subtilis |
  |
  |
  |
MG316 |
  |
sp: 1..19; tm: 25..45 48..68 120..140 152..172 207..227 235..255 268..288 323..343; |
J. Bacteriol. 180 (10), 2701-2710 (1998) putative HMW cytadherence operon (ref. see MP395); P43 |
MP390 |
471573..472682 |
| MPN452 |
complement(550662..552680) |
hmw3 |
g1674070 |
H08_orf672 |
conf, cytadherence accessory protein HMW3 |
  |
  |
  |
MG317 |
MPN618, MPN567, MPN447, MPN391, MPN309, MPN157, MPN154 |
lc: 219..244 283..299 304..346 381..465 615..630; |
Infect. Immun. 60 (4), 1633-1641 (1992) putative HMW cytadherence operon (ref. see MP395) |
MP389 |
469515..471533 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN453 |
complement(552694..553518) |
H08_orf274 |
g1674069 |
H08_orf274 |
conf, 30K adhesin-related protein |
  |
  |
  |
MG318 |
  |
sp: 1..28; tm: 77..97; cc: 99..148; lc: 149..164 172..272; |
J Bacteriol 1995Oct;177(20):5943-51 putative HMW cytadherence operon (ref. see MP395); P30; |
MP388 |
468677..469501 |
| MPN454 |
complement(553539..554120) |
H08_orf193 |
g1674068 |
H08_orf193 |
conserved hypothetical |
  |
  |
  |
MG319 |
  |
sp: 1..35; tm: 136..156; lc: 57..85 159..174; |
putative HMW cytadherence operon (ref. see MP395); P21; |
MP387 |
468075..468656 |
| MPN455 |
complement(554209..555072) |
ctaD |
g1674067 |
H08_orf287 |
conserved hypothetical |
  |
  |
  |
MG320 |
  |
sp: 1..47; tm: 66..86 104..124 135..155 171..191 207..227 254..274; |
old_gb exp: RNA data from ZMBH, RNA-expressed; |
MP386 |
467123..467986 |
| Ser-tRNA(TCC) |
555141..555232 |
mptgs |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
555141..555232 |
complement(466963..467054) |
| Ser-tRNA(TCG) |
555234..555322 |
mptgs |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
555234..555322 |
complement(466873..466961) |
| MPN456 |
complement(555398..558415) |
H08_orf1005 |
g1674066 |
H08_orf1005 |
conserved hypothetical |
  |
  |
  |
MG321 |
MPN459, MPN458, MPN457 |
sp: 1..19; lc: 110..131 604..637; |
exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP385 |
463780..466797 |
| MPN457 |
complement(558798..559787) |
H08_orf329V |
g1674064 |
H08_orf329V |
hypothetical see: MP385 |
  |
  |
  |
  |
MPN456 |
lc: 116..131 176..187; |
old_gb exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP384 |
462408..463397 |
| MPN458 |
complement(559729..560202) |
H08_orf157b |
g1674063 |
H08_orf157b |
conserved hypothetical,see: MP385 |
  |
  |
  |
  |
MPN456 |
lc: 70..84; |
  |
MP383 |
461993..462466 |
| MPN459 |
complement(560123..561898) |
H08_orf591 |
g1674062 |
H08_orf591 |
conserved hypothetical, see: MP385 |
  |
  |
  |
  |
MPN456 |
sp: 1..49; lc: 130..153; |
  |
MP382 |
460297..462072 |
| Leu-tRNA(CTA) |
complement(562058..562142) |
mptgv |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(562058..562142) |
460053..460137 |
| Lys-tRNA(AAG) |
complement(562147..562222) |
mptgv |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(562147..562222) |
459973..460048 |
| Thr-tRNA(ACA) |
complement(562235..562310) |
mptgv |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(562235..562310) |
459885..459960 |
| Val-tRNA(GTA) |
complement(562312..562387) |
mptgv |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(562312..562387) |
459808..459883 |
| Thr-tRNA(ACG) |
complement(562395..562469) |
mptgv |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(562395..562469) |
459726..459800 |
| Glu-tRNA(GAA) |
complement(562471..562547) |
mptgv |
  |
  |
in Genbank, /product="tRNA-Gln" is wrong. |
  |
  |
  |
  |
  |
  |
  |
complement(562471..562547) |
459648..459724 |
| Asn-tRNA(AAC) |
complement(562556..562630) |
mptgv |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(562556..562630) |
459565..459639 |
| MPN460 |
complement(562658..564355) |
ntpJ |
g1674061 |
H08_orf565 |
more_, ktrB |
  |
  |
Transporter, trk family; Na+ translocating, probably H+ or K+ antiporter; partner protein MP380; for ion maintenance of H,Na,K; perhaps Ca++ ? |
MG322 |
MPN054 |
sp: 1..21; tm: 29..49 109..129 163..183 259..279 316..336 404..424 461..481 526..546; |
SUB, subunit, MP380 is the partner; J. Bacteriol. 180 (13), 3491-3494 (1998) |
MP381 |
457840..459537 |
| MPN461 |
564390..565085 |
yzaC |
g1674060 |
H08_orf231 |
new_conf, KtrA, K+ Na+ uptake |
  |
1B3R-A |
Transporter, trk family; Na+ translocating, probably H+ or K+ antiporter; for ion level maintanance of all three; |
MG323 |
  |
  |
SUB, subunit, MP381 is the partner; J. Bacteriol. 180 (13), 3491-3494 (1998) new exp: RNA data from ZMBH, RNA-expressed; confirmed by COG569, reckognizes this also as potassium binding TrkA component; |
MP380 |
complement(457110..457805) |
| MPN462 |
565237..566049 |
H08_orf270 |
g1674059 |
H08_orf270 |
conf, see: MP013 |
  |
  |
  |
  |
MPN141, MPN128, MPN101, MPN502, MPN205 |
lc: 17..47 98..114; |
  |
MP379 |
complement(456146..456958) |
| MPN463 |
566124..566597 |
H08_orf157a |
g1674058 |
H08_orf157a |
conserved hypothetical |
  |
  |
  |
  |
MPN115, MPN091 |
lc: 135..148; |
MP specific exp: RNA data from ZMBH, RNA-expressed; |
MP378 |
complement(455598..456071) |
| MPN464 |
566891..568228 |
H08_orf445 |
g1674057 |
H08_orf445 |
new_conf, involved in cytadherence, see: MP012 |
  |
  |
  |
  |
MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN414, MPN367 |
lc: 174..187; |
exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP377 |
complement(453967..455304) |
| MPN465 |
complement(568645..569244) |
P01_orf199 |
g1674056 |
P01_orf199 |
conserved hypothetical |
  |
  |
  |
  |
MPN103, MPN037 |
tm: 72..92 100..120 145..165; |
MP specific exp: RNA data from ZMBH, RNA-expressed; |
MP376 |
452951..453550 |
| MPN466 |
complement(569288..569710) |
P01_orf140 |
g1674055 |
P01_orf140 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN148, MPN012, MPN011, MPN649, MPN646, MPN641, MPN505, MPN411, MPN369, MPN271 |
  |
exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP375 |
452485..452907 |
| MPN467 |
complement(569740..570045) |
P01_orf101 |
g1674054 |
P01_orf101 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN054, MPN012, MPN011, MPN654, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN523, MPN505, MPN411, MPN369, MPN271 |
sp: 1..31; |
less; exp: RNA data from ZMBH, RNA-expressed; |
MP374 |
452150..452455 |
| MPN468 |
570782..571408 |
P01_orf208V |
g1674052 |
P01_orf208V |
conserved hypothetical see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN131, MPN500, MPN409, MPN370, MPN286, MPN202 |
lc: 96..111 114..132 159..173; |
less |
MP373 |
complement(450787..451413) |
| RNaseP_RNA |
complement(571431..571801) |
No info |
  |
  |
The sequence in ZMBH www page is complementary strand. About RNaseP, see www.mbio.ncsu.edu/RNaseP. There is one-residue offset between the sequnece in RNaseP DB and ZMBH. I adopted the position of match with the sequence in RNaseP DB. There are 2 gaps and 1 mismatch between RNaseP in the Mp genome sequence and that in the RNaseP DB. |
  |
  |
  |
  |
  |
  |
  |
complement(571431..571801) |
450394..450764 |
| 10sa_RNA |
571825..572211 |
No info |
  |
  |
The sequence in ZMBH www page is complementary strand. About 10sa RNA (tmRNA), see sunflower.bio.indiana.edu/~kwilliam/tmRNA/home.html. |
  |
  |
  |
  |
  |
  |
  |
571825..572211 |
complement(449984..450370) |
| MPN469 |
complement(572254..572985) |
P01_orf243 |
g1674051 |
P01_orf243 |
conserved hypothetical |
  |
  |
  |
MG323.1 |
  |
tm: 38..58 99..119 144..164 206..226; |
MG-MP specific; Note 445 nts after this ORF and 109 nts before the next ORF stretches the MCS5 RNA homologue from MP (exp characterized only in M.capricolum; Matsuda et al., NAR 37,187-188 (1997); this is the RNA component of RNAse P |
MP372 |
449210..449941 |
| MPN470 |
complement(573026..574090) |
pepX |
g1674050 |
P01_orf354 |
conf, X-Pro dipeptidase |
  |
1CHM-A |
  |
MG324 |
  |
  |
J Bacteriol 1998 Sep;180(18):4781-9 exp: RNA data from ZMBH, no expression, is hypothetical; (but should be expressed from the logic) |
MP371 |
448105..449169 |
| MPN471 |
complement(574090..574251) |
rpmG |
g1674049 |
P01_orf53 |
conf, ribosomal protein L33 |
  |
  |
  |
MG325 |
  |
  |
SUB; |
MP370 |
447944..448105 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN472 |
complement(574270..575151) |
degV |
g1674048 |
P01_orf293 |
conserved hypothetical |
  |
  |
  |
MG326 |
MPN664 |
  |
broad distribution; exp: RNA data from ZMBH, RNA-expressed; |
MP369 |
447044..447925 |
| MPN473 |
complement(575157..575963) |
lip2 |
g1674047 |
P01_orf268 |
conf, triacylglycerol lipase (lip) 2 |
  |
1A7U-A |
Fatty acid and phospholipid metabolism; triacylglycerol lipase; Triacylglycerol + H2O = diacylglycerol + a fatty acid anion. |
MG327 |
MPN519, MPN445 |
  |
Gene 1995 May 26;158(1):107-11 |
MP368 |
446232..447038 |
| MPN474 |
complement(575950..579051) |
P01_orf1033 |
g1674046 |
P01_orf1033 |
new, coiled coil protein, putative structural protein involved in cytosceleton |
well coiled coil, 294-326; coil 355-654; coil 681-921 7 seg regions |
  |
  |
MG328 |
MPN310 |
cc: 294..326 355..636 681..921; lc: 249..262 666..679 976..994; |
new, similarities to: GIANTIN (GOLGI COMPLEX-ASSOCI... 84 3e-15 from Rat, UI: 98093490; rat hit Q420-972 S2327-2896 myosins etc. however, Filter is there; C-term part clear homology; uso1 intracell transport protein from yeast 1e-10 Q419-974 S1094-1632 protein could with this large coil regions be really a coiled coil with sceleton; cave coiled-coil destroys all function predictions; but may be really a structural protein in this case. |
MP367 |
443144..446245 |
| MPN475 |
complement(579408..580757) |
P01_orf292 |
g1674045 |
P01_orf292 |
more__, GTPase, GTP binding, see comments |
  |
121P |
regulatory function (?) |
MG329 |
MPN008, MPN656, MPN568, MPN481, MPN155 |
  |
new_add:GTP binding / GTPase, clear big family, full length; GenebankMG says cons hyp GTP-binding protein; Sternberg says P-loop containing nucleotide triphosphate hydrolase; swissprot says era/thdf family of GTP binding proteins. exact function needs more data, could include MYZUS PERSICAE PRIMARY ENDOSYMBIONT Q24-152 S218-346 added first: GroEL-like homolog MEDLINE; 98080423. 2e-11; New_add second: N-terminal sequence extended by Mikita total length 449 in accordance to homologs; unconnected; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP366 |
441909..442787 |
| MPN476 |
complement(580759..581412) |
cmk |
g1674043 |
P01_orf217 |
conf, cytidylate kinase |
  |
1AK2 |
ucleotide and deoxynucleotide degradation or rescue reaction. cytidylate kinase; NTP + cytidine = NDP + CMP. |
MG330 |
  |
  |
full length; exp evidence E.coli, B.sub ARCH. BIOCHEM. BIOPHYS. 340:144-153(1997)UI: 97271336; Note: Though nice primary sequence similarity EC protein alpha and coil, BS beta strands; difficult to say how the structure from MP will look |
MP365 |
440783..441436 |
| MPN477 |
complement(581439..582068) |
P01_orf209 |
g1674042 |
P01_orf209 |
conserved hypothetical |
  |
  |
  |
MG331 |
  |
tm: 186..206; cc: 19..41; lc: 133..145; |
exp: RNA data from ZMBH, RNA-expressed; |
MP364 |
440127..440756 |
| MPN478 |
complement(582071..582778) |
P01_orf235 |
g1674041 |
P01_orf235 |
new, similar to spore coat protein |
  |
  |
  |
MG332 |
  |
lc: 145..167; |
yebC family member conserved hypothetical proteins 1st iteration psi blast; 2nd psi converged; dbj BAA34259.1 (AB014075) Orf2u [Clostridium histolyticum]1e-74 and emb CAB14742 (Z99118) similar to spore coat protein [Bacillus subtilis] 1e-72 Q6-233 S9-237 new functional annotation; cons. hyp. in COG0217;exp: RNA data from ZMBH, RNA-expressed; |
MP363 |
439417..440124 |
| MPN479 |
complement(582782..583375) |
P01_orf197 |
g1674040 |
P01_orf197 |
new_conf, ACYL CARRIER PROTEIN PHOSPHODIESTERASE |
  |
  |
Fatty acid and phospholipid metabolism; [Acyl-carrier protein]+ H(2)O = 4'-phosphopantetheine + apoprotein. |
  |
  |
tm: 150..170; |
ACYL CARRIER PROTEIN PHOSPHODIESTERASE "Isolation and properties of acyl carrier protein phosphodiesterase of Escherichia coli." J. BACTERIOL. 172:5445-5449(1990) UI: 90368607, exp analysis of the protein 1e-06 Q3-169 S2-175; should have some flanking activities, connnected to MP500, phosphopantetheine adenylyltransferase; new_conf COG1182; exp: RNA data from ZMBH, RNA-expressed; |
MP362 |
438820..439413 |
| MPN480 |
complement(583403..585919) |
valS |
g1674039 |
P01_orf838 |
conf, valyl-tRNA synthetase |
SEG 368-377 seg 720-734 coil 768-734 seg 811-826 |
  |
  |
MG334 |
MPN023, MPN520, MPN384 |
cc: 768..824; |
clear; exp evidence N-term till res 367 3.9e-58 S.pombe, UI: 98284022. exp: RNA data from ZMBH, no expression, is hypothetical ! (and a tRNA should be expressed, always, shouldn't it ?) |
MP361 |
436276..438792 |
| MPN481 |
complement(585903..586484) |
yihA |
g1674038 |
P01_orf193 |
more_ , GTP binding, era like |
  |
1AA9 |
regulatory function (?) |
MG335 |
MPN008, MPN656, MPN475 |
  |
more_, blast: whole family; GTP binding era-family is probably right Q26-186 S 9-167 3e-4 to >sp O51604 ERA_BORBU (ERA..)GTP-BINDING PROTEIN ERA HOMOLOG.[BORRELIA BURGDORFERI] unconnected; exp:YIHA_ECOLI 98414051 shown to be essential in a knockout experiment; unconnected exp: RNA data from ZMBH, RNA-expressed; |
MP360 |
435711..436292 |
| MPN482 |
complement(586492..586686) |
  |
New identified |
New identified |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
  |
359-360 |
435509..435703 |
| MPN483 |
586772..587797 |
yibD |
g1674037 |
P01_orf341 |
more__, bifunctional threonine dehydrogenase; galactosyltransferase |
  |
  |
amino acid metabolism; L-threonine + NAD <-> 2-amino-3-ketobutyrate + NADH + H+ ; bifunctional: carbohydrate metabolism; sugar; sugar transferase |
MG335.2 |
  |
  |
more__, solid hit to EC threonine dehydrogenase (P11290; P22999 are, as noted before in genbank via swissprot), UI 89174812; Q2-245 S6-253 Score = 60.5 bits (144), Expect = 1e-08, Dekker group collected lots of exp. on the EC homologue; further clear similarity (whole family and around the EC hit) to galactosyl and other sugar transferases, e.g.MEDLINE; 98125733; broader specificity would allow both reactions,note further that the galactosyltransferase_2 domain (here 1-180AA)is found in a diverse set of enzymes; though there are here also complete length hits to such enzymes . exp: RNA data from ZMBH, RNA-expressed; |
MP359 |
complement(434398..435423) |
| MPN484 |
complement(588302..588613) |
P02_orf103b |
g1674036 |
P02_orf103b |
hypothetical, see: MP141 |
  |
  |
  |
  |
MPN151, MPN145, MPN139, MPN138, MPN130, MPN127, MPN104, MPN100, MPN094, MPN038, MPN013, MPN675, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 81..100; |
  |
MP358 |
433582..433893 |
| MPN485 |
complement(589030..589980) |
P02_orf316 |
g1674035 |
P02_orf316 |
more__, species specific lipoprotein see: MP353 |
  |
  |
  |
  |
MPN489, MPN444, MPN436 |
lc: 53..65 84..107 118..133 239..256 262..276; |
new_add; see MP 353 as longest representative; is also this MG homologue |
MP357 |
432215..433165 |
| MPN486 |
589922..590365 |
P02_orf147 |
g1674034 |
P02_orf147 |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
unclear; psi-blast converged to the sequence after 2nd iteration; exp: RNA data from ZMBH, RNA-expressed; |
MP356 |
complement(431830..432273) |
| MPN487 |
590569..591795 |
nifS |
g1674033 |
P02_orf408 |
more__, bifunctional; nifS-like; also related to tRNA splicing protein spl 1; molecular function: classV pyridoxal-phosphate-dependent transferase; subunit to MP355; |
SEG 238-250 |
1DGD |
  |
MG336 |
  |
lc: 238..250; |
more__, yurw protein, nifS family, clear by blast and exp evidence Pfam alignment PF00266 Transferases class-V b) however note Q 36-238 S 115-312 similar to tRNA splicing protein spl1 could perhaps also be involved in tRNA maturation in MP ?; furhtermore, E.coli nifS-like Gen is counterpart of mammalian selenocystein lyase; nitrogen fixation has also net yet been reported for MP, thus only the molecular function is sure;SUB, subunit, matches MP354; hypothesis sulfur scavenging, as the transferase gets selene or sulfur out, at least in the csdB E.coli homologue; JBC 274, 14768-14772 (1999); probably with broad enough specificity to do also other pyridoxal phosphate transfer reactions, e.g. aspartate aminotransferase (this latter function also recognized by Sternberg; not by genebank or swissprot); COGs describe NifS family as cysteine desulfurase related enzyme (leaving also some broader specificity open) |
MP355 |
complement(430400..431626) |
| MPN488 |
591798..592220 |
P02_orf140 |
g1674032 |
P02_orf140 |
new, nifU-like, complementing transferase subunit for MP354; |
  |
  |
  |
MG337 |
  |
lc: 121..135; |
new, blast yurv BS Q1-96 S7-100 with 0.016 also similar to TP0615 nifU with 0.54 plus neighbourhood should be complementing subunit to the transferase below: SUB, subunit matches MP 355; hypothesis: matching MP354:could hold Fe-S for assembly Zheng et al., JBC 273, 13264-13272 (1998); in genebank MG / Sternberg only cons. hyp, not recognized as subunit. In COG 822 NifU homologs involved in Fe-S cluster formation; though COG fits in context of our hypothesis, safest is to state that this is the matching subunit to the transferase activity of MP355 |
MP354 |
complement(429975..430397) |
| MPN489 |
complement(592398..596300) |
P02_orf1300 |
g1674030 |
P02_orf1300 |
more__, species specific lipoprotein |
signal seq 1-25 domain 1 25-436 low cplx domain II 516-643 low cplx domain III 659-926 low cplx 949-1023 low cplx domain IV 1046-1214 C-term 516-643 low cplx 659 |
  |
  |
MG338 |
MPN485, MPN444, MPN442, MPN440, MPN439, MPN437, MPN436 |
sp: 1..25; lc: 461..489 500..515 621..640 644..658 933..948 1024..1045 1215..1229; |
new_add; Longest representative for MP357 and MP353 domain 1 5e-09 hits species specific lipoprotein Mycoplasma gallisepticum exp evidence: Avian Dis 1991 Jan-Mar;35(1):62-9,UI: 91229561; domain 2 again lipoprotein family domain 3 hypothetical lipoprotein; |
MP353 |
425895..429797 |
| MPN490 |
complement(596816..597826) |
recA |
g1674029 |
P02_orf336 |
conf, recombination protein RecA |
  |
1REA |
DNA repair; replication; RECA PROTEIN CAN CATALYZE THE HYDROLYSIS OF ATP IN THE PRESENCE OF SINGLE-STRANDED DNA, THE ATP-DEPENDENT UPTAKE OF SINGLE-STRANDED DNA BY DUPLEX DNA, AND THE ATP-DEPENDENT HYBRIDIZATION OF HOMOLOGOUS SINGLE-STRANDED DNAS IT INTERACTS WITH LEXA CAUSING ITS ACTIVATION AND LEADING TO ITS AUTOCATALYTIC CLEAVAGE. |
MG339 |
  |
  |
clear full length; Q 37-322 S 48-332; C.glutamicum 9.5e-68 Literature/experiment: APPL. MICROBIOL. BIOTECHNOL. 42:575-580(1994), UI: 95134369 ; SUB, subunit, requires LexA to work; exp: RNA data from ZMBH, no expression, this is hypothetical ! However, this is a DNA repair protein, so check under condition of stress |
MP352 |
424369..425379 |
| MPN491 |
597900..599324 |
P02_orf474 |
g1674028 |
P02_orf474 |
new, membrane nuclease |
  |
  |
nucleotides; nuclease; membrane; |
  |
MPN333 |
sp: 1..16; lc: 175..212 262..296; |
new, exact exp evidence, expressed, antibodies, shown really in membrane; tr Q50321 (MNU)MEMBRANE NUCLEASE A.[MYCOPLASMA PULMONIS 6E-16 Q299-470 S291-463 nuclease exp with maxicells; PATHOGENICITY FACTOR J. Bacteriol. 181(6):1853-1860(1999),UI: 99173909; 2D gel elpo spot; sort of unconnected; exp: 2D-Gel data from ZMBH, TX-UF, 36kD (C-term), IEP 6.2 |
MP351 |
complement(422871..424295) |
| MPN492 |
complement(599463..600380) |
yjfW |
g1674027 |
P02_orf305 |
conf, similar to D-ARABINO-6-HEXULOSE 3-PHOSPHATE isomerase from E.coli |
  |
1BHW-A |
Energy metabolism, Sugars;ADD: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE ISOMERIZATION OF D-ARABINO-6-HEXULOSE 3-PHOSPHATE TO D-FRUCTOSE 6-PHOSPHATE |
  |
  |
  |
by similarity and neighbourhood; EC 2e-53 Q25-276 S8-261 in EC FUNCTION: ISOMERIZATION OF D-ARABINO-6-HEXULOSE 3-PHOSPHATE TO D-FRUCTOSE 6-PHOSPHATE. PATHWAY: PROBABLY PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE.HUMPI family; Story: would be operon, and small pathway formed by MP347-MP350 exp: RNA data from ZMBH, no expression, this is hypothetical ! really to check: Is this sugar inducible ?! |
MP350 |
421815..422732 |
| MPN493 |
complement(600316..600972) |
yjfV |
g1674026 |
P02_orf218 |
new_conf, 3-hexulose-6- phosphate synthase |
  |
  |
Energy metabolism, Sugars;ADD: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE CONDENSATION OF D-RIBULOSE 5-PHOSPHATE WITH FORMALDEHYDE TO FORM D-ARABINO-6-HEXULOSE 3-PHOSPHATE. HUMPS FAMILY the key enzyme of the RuMP cycle |
  |
  |
sp: 1..18; lc: 123..136; |
known before in swissprot, HUMPS FAMILY; well characterized in BS Arch Microbiol 1989, UI: 89373409; BS e-09 to the best gene found in BS Q24-210 S21-204 exp: RNA data from ZMBH, only 32 degrees, RNA-expressed; perhaps only semantics, but the true function should be noted in the annotation. |
MP349 |
421223..421879 |
| MPN494 |
complement(600974..601453) |
yjfU |
g1674025 |
P02_orf159 |
new_conf, similar to phosphotransferase protein II, component A, for pentitol, SGAT homolog |
  |
1A6J-A |
Energy metabolism, Sugars;ADD: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE PENTITOL PHOSPHOTRANSFERASE ENZYME II; transporter, phosphotransferase protein II, part of ribulose transporter (probably) |
  |
  |
  |
psi-blast: Clearly similar to the A component of enzyme II in a PTS system (EC 2.7.1.69); exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, Ges.; IEP at 6.4; new_conf swissprot |
MP348 |
420742..421221 |
| MPN495 |
complement(601455..601742) |
  |
New identified |
New identified |
similar to PTS system: EIIB |
  |
  |
  |
  |
  |
  |
  |
347-348 |
420453..420740 |
| MPN496 |
complement(601745..603727) |
yjfS |
g1674024 |
P02_orf660 |
new_conf, similar to phosphotransferase protein for pentitol from E.coli, SGAT homolog |
strong hint SMART: signal 1-36; SEG 4-15, 22-34 and 312-326; TM helices: Many, 11 high , 5 probable ones |
  |
Energy metabolism, Sugars;NEW: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE putative transport protein first gene, see MP350; transporter; ribulose transprot (probably, perhaps broader) |
  |
  |
sp: 1..36; tm: 73..93 101..121 162..182 194..214 229..249 309..329 362..382 421..441 450..470 480..500 614..634; lc: 400..413 639..651; |
protein (yjfS) homolog; psi-blast converges, but shows integral membrane protein and the E.coli SGAT similarity; similar to Swiss-Prot Accession Number P39301, from E. coli (which is the SGAT EC transporter) putative EC trapo protein SGAT 2e-63 Q 59-501 S 23-419;however, only by similarity of a similarity; makes more sense as part of an operon, see MP350 COULD ACT AS THE TRANSPORT PROTEIN FOR THE UNKNOWN PENTITOL SUBSTRATE OF THE SGA OPERON. SUBCELLULAR LOCATION: INTEGRAL MEMBRANE PROTEIN. INNER MEMBRANE (POTENTIAL). SIMILARITY: TO M.PNEUMONIAE SGAT HOMOLOG further strong hint SMART; exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, Gesamt; new_conf swissprot |
MP347 |
418468..420450 |
| MPN497 |
complement(604155..604586) |
P02_orf143 |
g1674023 |
P02_orf143 |
new_conf, similar to PHOSPHOTRIESTERASE HOMOLOGY PROTEIN |
  |
  |
if the function is exactly that then this would give: Intermediary metabolism, detoxification, phosphates; Aryl dialkyl phosphate + H(2)O = dialkyl phosphate + an aryl alcohol |
  |
MPN062 |
tm: 102..122; lc: 76..94; |
PHOSPHOTRIESTERASE HOMOLOGY PROTEIN 0.001 Q6-143; S59-182; E.coli only hint HYDROLASE; ZINC; 3D server yields nothing; sort of unconnected; COG 1735 confirms this |
MP346 |
417609..418040 |
| MPN498 |
604897..605625 |
araD |
g1674020 |
P02_orf242 |
conf, L-ribulose-5-phosphate 4-epimerase |
  |
2FUA |
Energy metabolism, Pentose Phosphate pathway; L-ribulose-5-phosphate 4-epimerase (araD); L-ribulose 5-phosphate = D-xylose 5-phosphate; |
  |
  |
lc: 59..71; |
EC 9e-56 Q 5-236 S 1-231 NAR 18:6722-6722(1990),UI: 91067495; note that the enzyme may have broader specificity, also related to EC fuculose aldolase classII 8.7e-07 Q 7-208 S 4-187 exp JMB 259, 458-466 (1996); part of a story, Peer has similar example, finidng out the further activities of PPP; |
MP345 |
complement(416570..417298) |
| MPN499 |
605579..606070 |
P02_orf163 |
g1674019 |
P02_orf163 |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
URF, real protein ? psi blast converged exp: RNA data from ZMBH, RNA-expressed; |
MP344 |
complement(416125..416616) |
| MPN500 |
606218..607801 |
P02_orf527V |
g1674018 |
P02_orf527V |
conf, see: MP013 |
  |
  |
  |
  |
MPN144, MPN141, MPN132, MPN131, MPN128, MPN099, MPN468, MPN409, MPN370, MPN286, MPN203, MPN202 |
lc: 9..26 43..55 96..117 375..395 489..515; |
  |
MP343 |
complement(414394..415977) |
| MPN501 |
608167..608757 |
P02_orf196 |
g1674017 |
P02_orf196 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 116..194; |
URF; exp: RNA data from ZMBH, RNA-expressed; |
MP342 |
complement(413438..414028) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN502 |
609202..610470 |
P02_orf422V |
g1674016 |
A05_orf278 |
conf,see: MP013 |
  |
  |
  |
  |
MPN141, MPN128, MPN101, MPN462, MPN370, MPN205 |
lc: 23..39 131..140 170..188; |
konvergiert - Himmelreich,R., Hilbert,H., Plagens,H., Pirkl,E., Li,B.C. and Herrmann,R. TITLE Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae JOURNAL Nucleic Acids Res. 24 (22), 4420-4449 (1996), aber ist das 100%ig sicher, seine Expertenmeinung ? aber zusaetzlich: Percent Similarity: 44.521 Percent Identity: 21.918 bestfit Percent Similarity: 44.218 Percent Identity: 21.769 gap P11311 is well characterizedRA SU C.-J., TRYON V.V., BASEMAN J.B.; "Cloning and sequence analysis of cytadhesin P1 gene from Mycoplasma pneumoniae."; INFECT. IMMUN. 55:3023-3029(1987),UI: 8805759; |
MP341 |
complement(411725..412993) |
| MPN503 |
611025..612170 |
P02_orf381 |
g1674015 |
P02_orf381 |
new_conf, protein family involved in cytadherence, see: MP012 |
  |
  |
  |
  |
MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN468, MPN464, MPN414, MPN367, MPN366 |
lc: 61..78; |
exp: RNA data from ZMBH, RNA-expressed; |
MP339 |
complement(410025..411170) |
| MPN504 |
612740..613120 |
P02_orf126 |
g1674014 |
P02_orf126 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 97..125; lc: 43..55; |
URF; exp: RNA data from ZMBH, RNA-expressed; |
MP338 |
complement(409075..409455) |
| MPN505 |
complement(613188..613949) |
P02_orf253 |
g1674013 |
P02_orf253 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN551, MPN467, MPN466, MPN411, MPN369, MPN271 |
sp: 1..24; |
  |
MP337 |
408246..409007 |
| MPN506 |
614865..617246 |
P02_orf793 |
g1674012 |
P02_orf793 |
conserved hypothetical, see: MP631 |
  |
  |
  |
  |
MPN152, MPN147, MPN146, MPN098, MPN097, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 |
sp: 1..27; cc: 526..552; lc: 38..52 218..237 491..505 558..570; |
see comments to MP631. |
MP336 |
complement(404949..407330) |
| MPN507 |
617366..618457 |
P02_orf363V |
g1674010 |
P02_orf363V |
conf, type I restriction enzyme ecokI specificity protein (hsdS) homolog; similar to GenBank Accession Number E64055, from H. influenzae |
  |
  |
DNA metabolism; restriction enzyme; |
  |
MPN089, MPN615, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201 |
  |
representative for family MP066 MP227 MP335 MP471 MP493 MP545 MP546 MP550 MP630 1.7e-20 till 326; to M.pulmonis; exp evidence DYBVIG K., SITARAMAN R., FRENCH C.T. PNAS(1998), UI: 99030671 ; story note: A family of phase-variable restriction enzymes with differing specificities generated by high- frequency gene rearrangements; SUB, subunit, for all family memebers, this is always hsdS, subunits hsdR, hsdM are also required; Story: Recombination between these different genes, see PNAS article; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP335 |
complement(403738..404829) |
| MPN508 |
complement(618485..620014) |
P02_orf509 |
g1674009 |
P02_orf509 |
new, membrane export protein family |
coil 201-256 |
  |
  |
  |
MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN234 |
cc: 201..256; |
new, protein gets exported over the membrane and the membrane translocation function affects expression of antigenic translational products; MP334 representative of the family MP105 MP106 MP330 MP331 MP332 MP333 MP597 blast, psi whole protein: is a family, N-term part lipoprotein like; but very closed family; more iterations are possible; SMART: nothing known; C-terminal part even after 4 psi-blast iterations still hypothetical membrane protein; converges at step 7, full family only in MP and MG but many members N-terminal part: 7e-04 M.hyorhinis Q41-200 S564-742 exp evidence:Sequence and TnphoA analysis of a Mycoplasma hyorhinis protein with membrane export function. Yogev,D. et al.J. Bacteriol. 173 (6), 2035-2044 (1991),UI: 91161521, believe as convincing hint from a related organism and clear experiment; caveat: Only part of protein; |
MP334 |
402181..403710 |
| MPN509 |
complement(620561..621844) |
P02_orf427 |
g1674008 |
P02_orf427 |
new, membrane export protein family see: MP334 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN508, MPN234, MPN161 |
cc: 109..156; |
new, see MP 334 |
MP333 |
400351..401634 |
| MPN510 |
complement(622874..624250) |
P02_orf458 |
g1674007 |
P02_orf458 |
new, membrane export protein family see: MP334 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN509, MPN508, MPN234 |
cc: 187..224; |
new, see MP 334 |
MP332 |
397945..399321 |
| MPN511 |
complement(624862..625644) |
F04_orf260V |
g1674006 |
F04_orf260V |
new, membrane export protein family see: MP334 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN041, MPN036, MPN035, MPN510, MPN509, MPN508, MPN234 |
lc: 193..207; |
new, see MP 334 |
MP331 |
396551..397333 |
| MPN512 |
complement(625675..626139) |
F04_orf154 |
g1674005 |
F04_orf154 |
new, membrane export protein family see: MP334 |
  |
  |
  |
  |
MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN510, MPN509, MPN508, MPN234, MPN161 |
cc: 119..153; |
new, putative, see MP334 |
MP330 |
396056..396520 |
| MPN513 |
complement(626917..627369) |
F04_orf150 |
g1674004 |
F04_orf150 |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
converged after first psi-blast on itself exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP329 |
394826..395278 |
| MPN514 |
complement(627886..628248) |
F04_orf120 |
g1674003 |
F04_orf120 |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
URF, hits only replication like regions, not convincing exp: RNA data from ZMBH, RNA-expressed; |
MP328 |
393947..394309 |
| MPN515 |
complement(628410..632282) |
rpoC |
g1674001 |
F04_orf1290 |
conf, DNA-directed RNA polymerase beta' chain |
  |
  |
Transkription; |
MG340 |
  |
lc: 3..20 330..342 1221..1233; |
DNA-directed RNA polymerase beta' chain; whole family Thermotoga maritima 1E-180 S 464-867 Q 237-644 exp. evidence, UI: 94232816, NAR 21, 4904-4908 (1993;sub, subunit, one further is MP326, but there is the alpha-subunit at least missing; |
MP327 |
389913..393785 |
| MPN516 |
complement(632286..636461) |
rpoB |
g1674000 |
G12_orf1391o |
conf, RNA polymerase beta subunit |
seg 166-177 potential TM helices 181-201; 499-519; 660-680; 752-772 |
  |
Transkription; |
MG341 |
  |
  |
RNA polymerase beta subunit clear hit by blast; whole family; exp data e.g. for R.prowazecki causative agent for typhus Q 411-1052; S 345-975;1.1e-229 J. BACTERIOL. 180:2118-2124(1998), UI: 98215179; sub, subunit, one further is MP327, but there is the alpha-subunit at least missing; |
MP326 |
385734..389909 |
| MPN517 |
complement(636554..637054) |
G12_orf166a |
g1673999 |
G12_orf166a |
new_conf, suggest reductase homologue |
  |
1QRD-A |
  |
MG342 |
  |
  |
new_conf, reductase homologue, tentative: Streptomyces cyanogenus Q2-154 S 9-160 0.037 AAD13563 Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis, UI: 99132695; also classified as reductase in search for homologous structure; unconnected; not found in GenebankMG or swissprot(cons hyp), but by Sternberg as NADPH quinon-reduktase. |
MP325 |
385141..385641 |
| MPN518 |
complement(638147..639193) |
G12_orf348 |
g1673998 |
G12_orf348 |
conserved hypothetical |
  |
  |
  |
MG343 |
  |
  |
blast unclear, nucleotide binding, processing or so; unconnected |
MP324 |
383002..384048 |
| MPN519 |
complement(639196..640014) |
lip3 |
g1673997 |
G12_orf272V |
conf, triacylglycerol lipase (lip) 3 |
  |
1A7U-A |
Fatty acid and phospholipid metabolism; triacylglycerol lipase; Triacylglycerol + H2O = diacylglycerol + a fatty acid anion. see also MP396, MP368 with similar activity |
MG344 |
MPN473, MPN445 |
lc: 137..148; |
triacylglycerol lipase (lip) 3; experimental certified for M.mycoides; full length similarity RAWADI G., LALANNE J.L., ROULLAND-DUSSOIX D.,UI: 95309706; Cloning and characterization of the lipase operon from Mycoplasma mycoides subspecies mycoides LC.Gene. 1995 May 26;158(1):107-11 |
MP323 |
382181..382999 |
| MPN520 |
complement(640132..642717) |
ileS |
g1673995 |
G12_orf861 |
conf, isoleucine-tRNA ligase |
  |
  |
protein translation |
MG345 |
MPN023, MPN480, MPN384 |
lc: 225..239; |
very clear by Blast full length; e.g. E.coli exp. many papers. |
MP322 |
379478..382063 |
| MPN521 |
642760..643260 |
ygl3 |
g1673994 |
G12_orf166b |
new_conf, putative rRNA methylase |
  |
  |
protein translation (putative) |
MG346 |
MPN355 |
  |
new_conf probably Koonin spotted it, too; smart nothing. blast clear methyltransferase, hypothetical family EC e-23 Q6-158 S2-150 KOONIN E.V., RUDD K.E.; "SpoU protein of Escherichia coli belongs to a further discovered family of putative rRNA methylases."; NUCLEIC ACIDS RES. 21:5519-5519(1993). SIMILARITY: BELONGS TO THE RNA METHYLTRANSFERASE TRMH FAMILY. STRONG, TO H.INFLUENZAE HI0766. spou family; UI: 94089409.CAUTION: POSSIBLY IDENTICAL TO GLTE. guanosine-o-methylftransferase EC only 0.25; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP321 |
complement(378935..379435) |
| MPN522 |
643251..643883 |
G12_orf210V |
g1673993 |
G12_orf210V |
new_conf, similar to methyltransferase |
  |
1XVA-A |
methyltransferase, unconnected |
MG347 |
  |
  |
new_conf, BAHR A., HANKELN T., FIEDLER T., HEGEMANN J., SCHMIDT E.R.; "Molecular analysis of METTL1, a novel human methyltransferase-like gene with a high degree of phylogenetic conservation.", UI 99263505; 4e-05 Q34-155 S71-197 CAA77240; and enough other homology/ further hits evidence for methyltransferase. Found also in EMBL 3D predictor, not found in Chothia. found in latest COGs 0220 pred. S-adensoyldep. methyltr.;old genbank pointer F64148 leeds into nothing;exp: RNA data from ZMBH, expressed at 32 degrees, RNA-expressed; Methyltransferase family was recognized by Sternberg, not yet by Genebank MG; we can add the novel family; |
MP320 |
complement(378312..378944) |
| His-tRNA(CAC) |
643913..643988 |
mptgh |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
643913..643988 |
complement(378207..378282) |
| MPN523 |
complement(644038..644955) |
G12_orf305 |
g1673992 |
G12_orf305 |
more_, probably membrane component, similar to STARP antigen |
Seg 2-31 signal 1-30 seg 259-279 |
  |
  |
MG348 |
MPN128 |
sp: 1..30; lc: 259..279; |
more_, similar to STARP antigen [Plasmodium reichenowi] 2e-04 Q43-257 S190-404; |
MP319 |
377240..378157 |
| Leu-tRNA(CTC) |
complement(644970..645055) |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(644970..645055) |
377140..377225 |
| MPN524 |
complement(645545..646051) |
G12_orf168 |
g1673991 |
G12_orf168 |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 104..167; lc: 43..55; |
URF exp: RNA data from ZMBH, RNA-expressed; |
MP318 |
376144..376650 |
| MPN525 |
646644..647885 |
G12_orf413 |
g1673990 |
G12_orf413 |
conserved hypothetical |
Seg 225-241 |
  |
  |
MG349 |
  |
lc: 224..243; |
MG349 homolog, from M. genitalium psi blast converged; exp: RNA data from ZMBH, expressed at 32 degrees, RNA-expressed; |
MP317 |
complement(374310..375551) |
| MPN526 |
647866..648852 |
G12_orf328b |
g1673989 |
G12_orf328b |
conserved hypothetical |
  |
  |
  |
MG350 |
  |
cc: 159..187; lc: 28..41; |
MG350 homolog, from M. genitalium; psi nothing else; exp: RNA data from ZMBH, RNA-expressed; |
MP316 |
complement(373343..374329) |
| MPN527 |
complement(649107..649784) |
G12_orf225 |
g1673988 |
G12_orf225 |
new, putative membrane integrated oxidoreductase |
TM 20-40 Seg 20-35 TM 56-76 TM 88-108 TM 121-141 seg 127-147 possible Trans 144-164 TM 173-193 (6 TM helices, for sure a membrane integrated protein) |
  |
membrane oxidoreductase, unconnected |
MG350.1 |
  |
sp: 1..47; tm: 56..76 88..108 121..141 173..193; |
new, putative membrane close oxidoreductase indications: MG close homologue NADH dehydrogenase subunit 5 [Onchocerca 38 0.069 Q 91-217 S 387-528 and a lot of other NADH UBIQUINONE dehydrogenases SMART 6 TM helices, pointing to membrane integrated protein; SUB, subunit; unconnected; |
MP315 |
372411..373088 |
| MPN528 |
649839..650393 |
ppa |
g1673987 |
G12_orf184 |
conf, inorganic pyrophosphatase |
  |
117E-A |
Central intermediary metabolism, Phosphorous compounds;inorganic pyrophosphatase (ppa); PYROPHOSPHATE + H(2)O = 2 ORTHOPHOSPHATE; |
MG351 |
  |
  |
whole family A.thaliana 4.3e-24 Q 5-162; S 50-207; whole family PLANT MOL. BIOL. 16:345-348(1991) UI: 91370878. |
MP314 |
complement(371802..372356) |
| MPN529 |
complement(650917..651246) |
G12_orf109 |
g1673985 |
G12_orf109 |
new_conf, bacterial histone like protein |
  |
  |
protein translation |
MG353 |
  |
  |
new_conf: Koonin says DNA-binding (Tobias) not clear; converges quickly in psi-blast; story: there is a protein in the MP313-MP314 intergenic region (see Mikita's list) - this and MP313 are together in MG and BS (jopC jopB) - they may interact forming a functional unit |
MP313 |
370949..371278 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN530 |
651395..651805 |
G12_orf136 |
g1673984 |
G12_orf136 |
conserved hypothetical |
  |
  |
protein translation |
MG354 |
  |
  |
not clear; converges quickly in psi-blast; exp: RNA data from ZMBH, RNA-expressed; |
MP312 |
complement(370390..370800) |
| MPN531 |
complement(651802..653949) |
clpB |
g1673983 |
G12_orf715 |
conf, ATP-dependent protease binding subunit ClpB |
No known SMART domains detected; coil 266-352; seg 391-402 seg 409-423 |
1D2N-A, 1D2N-A |
protein translation |
MG355 |
MPN138, MPN161 |
cc: 266..351; lc: 409..423; |
clpB protein family member, ATPase subunit 4.9e-167 to EC Q 10-709 S 156-856 Lit BIOCHEM. BIOPHYS. RES. COMMUN. 180:1222-1226(1991) J. BACTERIOL. 173:4254-4262(1991) PNAS 87, 3513-3517 (1990); SUB, subunit;UI: 92062147. |
MP311 |
368246..370393 |
| MPN532 |
complement(654125..654973) |
licA |
g1673982 |
G12_orf282b |
wrong_, stronger similar to choline kinase |
  |
1A06 |
Fatty acid and phospholipid metabolism; ATP + choline = ADP + O-phosphocholine |
MG356 |
  |
  |
wrong in genbank, licA comes in first psi blast iteration at 0.013; however choline kinase from Streptococcus pneumoniae is closer and has 5e-04 |
MP310 |
367222..368070 |
| MPN533 |
complement(654981..656153) |
ackA |
g1673981 |
G12_orf390 |
conf, acetate kinase |
  |
  |
Central intermediary metabolism, Other; acetate kinase (ackA); Note: Propanoate also acts as acceptor, but more slowly. acetate + ATP = ADP + acetyl phosphate; |
MG357 |
  |
  |
clear hit, whole family; EC 8e-71 Q 1-388 S 1-399 J. Bacteriol. 171 (1), 577-580 (1989) UI: 89123075. |
MP309 |
366042..367214 |
| MPN534 |
656494..656916 |
G12_orf140b |
g1673980 |
G12_orf140b |
conserved hypothetical, RNA-expressed, see comment |
  |
  |
  |
  |
  |
  |
real function ? psi blast first: alone; converged with one sequence; SMART nothing; exp: RNA data from ZMBH, RNA-expressed; |
MP308 |
complement(365279..365701) |
| MPN535 |
656922..657542 |
ruvA |
g1673979 |
G12_orf206 |
conf, Holliday junction DNA helicase RuvA |
  |
1BVS-A |
transcription, DNA repair |
MG358 |
  |
  |
Q 64-192; S 61-200 EC 4e-05 Lit J.Bacteriol 170, 4322-4329, UI: 88314937.subunit, sub; |
MP307 |
complement(364653..365273) |
| MPN536 |
657517..658440 |
ruvB |
g1673978 |
G12_orf307 |
conf, Holliday junction DNA helicase RuvB |
  |
1D2N-A |
transcription, DNA repair |
MG359 |
MPN671 |
  |
clear; EC 3e-50; Q8-303 S25-327; Lit J.Bacteriol 170, 4322-4329, UI: 88314937. subunit, sub; |
MP306 |
complement(363755..364678) |
| MPN537 |
complement(658426..659664) |
mucB |
g1673977 |
G12_orf412 |
conf, UV protection protein MucB |
  |
  |
DNA repair |
MG360 |
MPN535 |
lc: 20..30; |
full length; EC exp Q 31-334, S13-328, 5e-14 PNAS 82, 4331-4335 (1985)UI: 85242678; note umuDC does not complement mucAB; SUB, subunit; exp: RNA data from ZMBH, only once low expressed at 32 degrees (but should only be expressed with UV, shouldn't it ?) |
MP305 |
362531..363769 |
| MPN538 |
659782..660267 |
rpsJ |
g1673976 |
G12_orf161 |
conf, ribosomal protein L10 |
  |
  |
protein translation |
MG361 |
  |
  |
SUB; full length; whole family EC 9E-06 exp evidence, UI: 76257859. |
MP304 |
complement(361928..362413) |
| MPN539 |
660305..660673 |
rplL |
g1673975 |
G12_orf122 |
conf, ribosomal protein L7/L12 ('A' type) |
  |
1CTF |
protein translation |
MG362 |
  |
tm: 30..50; |
SUB; full length; whole family EC 4e-13 Lit Eur J Biochem 34, 138-152 (1973) UI: 73169380 |
MP303 |
complement(361522..361890) |
| MPN540 |
660680..660853 |
rpmF |
g1673974 |
G12_orf57 |
conf, ribosomal protein L32 |
SEG 6-20 SEG 21-57 |
  |
protein translation |
MG363 |
  |
lc: 6..20; |
SUB; full length, whole family; EC exp. UI: 76119562 |
MP302 |
complement(361342..361515) |
| MPN541 |
complement(660863..661126) |
rpsT |
g1673973 |
G12_orf87 |
conf, ribosomal protein S20 |
  |
  |
protein translation |
MG363.1 |
  |
  |
SUB; full length; whole family; Lit ref EC 0.00011 FEBS Lett 68, 110-114 (1976) UI: 77003692 |
MP301 |
361069..361332 |
| MPN542 |
661187..661843 |
G12_orf218 |
g1673971 |
G12_orf218 |
conserved hypothetical |
  |
  |
  |
MG364 |
  |
sp: 1..33; cc: 184..217; |
?; unknown function; signal 1-33; coil 184-218 middle psi converged 1st iteration MG13 random reading frame; exp: RNA data from ZMBH, highly expressed, RNA-expressed; |
MP300 |
complement(360352..361008) |
| MPN543 |
661848..662783 |
fmt |
g1673970 |
G12_orf311 |
conf, methionyl-tRNA formyltransferase |
  |
1FMT-A |
  |
MG365 |
  |
  |
full length; e.g. 2-103 to EC 5-304 exp EC evidence: J Bacteriol 174, 4294-4301 (1992) UI: 92325012,and J Bacteriol 175, 993-1000 (1993),UI: 93163064. exp: RNA data from ZMBH, only once, 32 degrees; |
MP299 |
complement(359412..360347) |
| MPN544 |
662783..664777 |
G12_orf664 |
g1673969 |
G12_orf664 |
conserved hypothetical |
SEG 80-94 SEG 223-234 |
  |
  |
MG366 |
  |
  |
psi blast converged; 3rd part 235-664 has some low but reoccuring similarity to nuclear polyhedral protein p74 |
MP298 |
complement(357418..359412) |
| MPN545 |
complement(664761..665609) |
rnc |
g1673968 |
G12_orf282a |
conf, ribonuclease III |
  |
  |
  |
MG367 |
  |
lc: 265..280; |
big family, EC J. BACTERIOL. 171:2581-2590(1989)UI: 89213943, 4.1e-11 Q 56-199 S 38-182 |
MP297 |
356586..357434 |
| MPN546 |
complement(665599..666585) |
plsX |
g1673967 |
G12_orf328a |
conf, fatty acid/phospholipid synthesis protein PlsX |
  |
  |
Fatty acid and phospholipid metabolism; what plsX exactly does is unclear |
MG368 |
  |
  |
fatty acid/ phospholipid synthesis protein PlsX is believable EC 1.4e-27 4-314 S3-318 part of the cluster plsX-fabH-fabD-fabG-acpP-fabF at min 24; plsX itself is transcribed. J Bacteriol 1997, 179(23):7257-63, UI: 9805383;sn-glycerol-3-phosphate acyltransferase (plsB) E. coli plsX, a gene that plays a poorly understood role in phospholipid synthesis J Bacteriol 1996 Aug;178(16):4794-800,UI: 96326321, but clear genetic evidence: Isogenic plsB+ plsX+, plsB+ plsX50, and plsB26 plsX+ strains grew equally well on glucose minimal medium without sn-glycerol-3-phosphate J Bacteriol 1984 Nov;160(2):711 |
MP296 |
355610..356596 |
| MPN547 |
complement(666585..668261) |
G12_orf558 |
g1673966 |
G12_orf558 |
new_conf, dihydroacetone kinase |
No known domains from SMART; SEG 300-314 SEG 523-538 |
  |
  |
MG369 |
  |
lc: 523..538; |
new_conf, 1st domain (till 300)shows clear and high e value homology to many dihydroxyacetone kinases but this function may be further modified, regulated by the rest of the protein exp: RNA data from ZMBH, only once, 32 degrees; confirmed also by COG1461, "related to dihydroxy acetone kinase" |
MP295 |
353934..355610 |
| MPN548 |
complement(668316..669296) |
G12_orf326 |
g1673965 |
G12_orf326 |
new, pseudouridine synthase |
15-72, S4 RNA binding domain; |
  |
uracil + D-ribose 5P -> pseudouridine 5P + water |
MG370 |
MPN292 |
lc: 77..89; |
SUB; new, ribosomal large subunit pseudouridine synthetase belongs to the rlu family; EC query res 16-288, UI: 99190868, Acta Crystall D Biol Crystallogr (1999) 55, 302-304; S4 RNA binding domain (SMART) from res. 15-72 e=9.9-06; COG564 states already predicted pseudo uridilate synthase family; here we upgrade this new annotation further: More specific and giving a direct experimental link; |
MP294 |
352899..353879 |
| MPN549 |
complement(669283..670260) |
G12_orf325 |
g1673964 |
G12_orf325 |
new_conf, phosphodiesterase |
15-315, DHH domain; |
  |
  |
MG371 |
MPN140 |
lc: 32..49; |
new_conf, belongs to the MGPA/MG371 family; pfam1368 phosphodiesterase; furthermore the DHH Smart domain is given on the left. Koonin and Aravind DHH domain description UI98138617 . Domain covers the protein |
MP293 |
351935..352912 |
| MPN550 |
complement(670253..671416) |
G12_orf387 |
g1673963 |
G12_orf387 |
new_conf, Thiamin biosynthesis protein |
  |
1GPM-A, 1NSY-A |
  |
MG372 |
  |
lc: 93..104; |
new_conf, e.g. EC has e=3.7-33 Characterization of thiI a gene involved in thiazole biosynthesis in S.typhimurum J Bact 179, 4399-4402 (1997); exp: RNA data from ZMBH, RNA-expressed; thoguh Sternberg and GenebankMG latest version fail to reckognize the thiI function (just say NTP utilizing pyrophosphatase), swissprot has already this annotation. |
MP292 |
350779..351942 |
| MPN551 |
complement(671403..672248) |
G12_orf281 |
g1673962 |
G12_orf281 |
conserved hypothetical |
  |
  |
  |
MG373 |
MPN505 |
  |
orthologue MG; Psi-blast converged; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP291 |
349947..350792 |
| MPN552 |
complement(672255..673064) |
G12_orf269 |
g1673961 |
G12_orf269 |
conserved hypothetical |
  |
  |
  |
MG374 |
  |
  |
psi-blast converged; MG clear orthologue exp: RNA data from ZMBH, no expression, this is hypothetical; |
MP290 |
349131..349940 |
| MPN553 |
complement(673057..674751) |
thrSv |
g1673960 |
G12_orf564 |
conf, threonyl-tRNA synthetase |
  |
1ATI-A, 1SER-B |
protein translation |
MG375 |
  |
sp: 1..17; |
clear, full protein; exp. evidence, e.g. yeast NAR 13, 6171-6183 (1985) UI: 86016080; RNA data from ZMBH: no expression, this is hypothetical; |
MP289 |
347444..349138 |
| MPN554 |
complement(674751..675065) |
G12_orf104 |
g1673959 |
G12_orf104 |
conserved hypothetical |
  |
  |
  |
MG376 |
  |
  |
similar to single-stranded binding protein Staph. U96108 with e=0.033 exp: RNA data from ZMBH, RNA-expressed; |
MP288 |
347130..347444 |
| MPN555 |
complement(675067..675648) |
H03_orf193o |
g1673958 |
H03_orf193o |
conserved hypothetical |
  |
  |
  |
MG377 |
  |
  |
psi-blast converged SMART, pfam mute; one domain protein; exp: RNA data from ZMBH, RNA-expressed; |
MP287 |
346547..347128 |
| MPN556 |
complement(675691..677304) |
argS |
g1673957 |
H03_orf537 |
conf, arginyl-tRNA synthetase |
  |
1GLN |
  |
MG378 |
  |
lc: 504..518; |
exp: _BRELA |
MP286 |
344891..346504 |
| MPN557 |
677332..679170 |
gidA |
g1673956 |
H03_orf612 |
new_conf, NADH-binding oxidoreductase GidA |
  |
1FEA-A |
  |
MG379 |
MPN390 |
  |
new_conf, in last version of COGs, COG 0445 correctly (as far as we know)annotated as NAD/FAD-utilizing enzyme apparently involved in cell division |
MP285 |
complement(343025..344863) |
| MPN558 |
679163..679738 |
gidB |
g1673955 |
H03_orf191 |
new_conf, methyltransferase GidB |
  |
1BHJ-A |
  |
MG380 |
  |
  |
new_conf, in last version of COGs; COG0357 correctly (as far as we know) annotated as Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division |
MP284 |
complement(342457..343032) |
| MPN559 |
679692..680399 |
H03_orf235 |
g1673954 |
H03_orf235 |
conserved hypothetical |
  |
  |
  |
MG381 |
  |
  |
exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP283 |
complement(341796..342503) |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| Arg-tRNA(AGA) |
complement(680400..680475) |
mptgab |
  |
  |
  |
  |
  |
  |
  |
  |
  |
  |
complement(680400..680475) |
341720..341795 |
| MPN560 |
complement(680477..681793) |
arcA |
g1673953 |
H03_orf438 |
conf, arginine deiminase |
  |
  |
Energy metabolism; Amino acids and amines; arginine + H2O = citrullin + NH3; note that there is a similar enzyme at MP531/MP532; |
  |
MPN305, MPN304 |
  |
exp: Bacillus licheniformis pheno: growth on arginine? needs also transporter and arcB (ornithine carbamoyltransferase) and arcD (putative arginine-ornithine antiporter), arcC (carbamate kinase) not in MG |
MP282 |
340402..341718 |
| MPN561 |
681847..682488 |
udk |
g1673952 |
H03_orf213 |
conf, uridine kinase |
  |
1A7J |
Purines, pyrimidines, nucleosides and nucleotides, Nucleotide and nucleoside interconversions; uridine kinase (udk); ATP + Uridine = ADP + UMP. Note: Cytidine works also; |
MG382 |
  |
  |
exp: _ecoli can also act on cytidine?! |
MP281 |
complement(339707..340348) |
| MPN562 |
complement(682485..683231) |
outB |
g1673951 |
H03_orf248 |
conf, probable NH(3)-dependent NAD(+) synthetase |
  |
1NSY-A |
nucleotide metabolism, cofactors; NAD synthase; ATP + deamido-NAD(+) +NH3 = AMP + diphosphate + NAD+; L-glutamine also acts, more slowly, as amido-donor (cf. EC 6.3.5.1). |
MG383 |
MPN422 |
  |
exp: _RHOCA; exp: RNA data from ZMBH, but only low expression once (282) at 32 degress; |
MP280 |
338964..339710 |
| MPN563 |
complement(683224..684525) |
obg |
g1673950 |
H03_orf433 |
conf, small GTPase OBG involved in cell growth |
domain 1-160 domain 2 161-300 domain 3 301-ct |
1AIP-A |
  |
MG384 |
MPN026, MPN568 |
lc: 32..44; |
domain 161-300 is small GTPase, nt/ct OBG-specific exp: _BACSU SPO0B-ASSOCIATED GTP-BINDING PROTEIN |
MP279 |
337670..338971 |
| MPN564 |
complement(684729..685784) |
adh |
g1673949 |
H03_orf351 |
less, similar to NADP-dependent alcohol dehydrogenase |
  |
1YKF |
  |
  |
  |
tm: 167..187; |
exp: Thermoanaerobacter brockii |
MP278 |
336411..337466 |
| MPN565 |
complement(685998..686456) |
H03_orf152 |
g1673948 |
H03_orf152 |
conserved hypothetical |
  |
  |
  |
MG384.1 |
  |
sp: 1..42; tm: 43..63 70..90; lc: 133..151; |
100aa hydrophobic, 1 huge tm? ?URF; exp: RNA data from ZMBH, RNA-expressed; |
MP277 |
335739..336197 |
| MPN566 |
complement(686626..687339) |
glpQ |
g1673947 |
H03_orf237 |
less, Glpq or Uplq glycerophosphoryl diester phosphodiesterase |
  |
  |
Central intermediary metabolism, Other; glycerophosphoryl diester phosphodiesterase(glpQ); as is MP421 - e.g. different allosteric regulation, specificity etc. ? glycerophosphodiester + H2O = an alcohol + sn-glycerol 3-phosphate; |
MG385 |
MPN420 |
cc: 114..139; |
exp: _BACSU: glpq clarification needed whether Glpq or Uplq |
MP276 |
334856..335569 |
| MPN567 |
complement(687343..690453) |
P200 |
g1673946 |
D02_orf1036o |
conf, similar to cyto adherence proteins |
170-225, repeated domain 226-280, repeated domain 630-680, repeated domain 850-899, repeated domain 900-945, repeated domain 946-990 repeated domain |
  |
  |
MG386 |
MPN119, MPN452, MPN447, MPN343 |
lc: 353..373 397..411 486..501 540..557 565..601 604..626 707..721 726..758 770..787; |
story: contains a domain, exclusive to MP/MG, common to another cytadherence protein (MP394) and to a protein with probable cochaperone activity (MP035) |
MP275 |
331742..334852 |
| MPN568 |
complement(690553..691428) |
spg |
g1673945 |
D02_orf291 |
more_, small GTPase ERA involved in regulating metabolism and cell division |
  |
1AIP-A |
cell division |
MG387 |
MPN008, MPN656, MPN563, MPN475 |
lc: 95..110; |
exp: _ecoli exp: _salty check other GTPases! neighborhood with hemolysin export; unconnected; only once expressed at 32 degree, but probably truly expressed; |
MP274 |
330767..331642 |
| MPN569 |
complement(691416..691742) |
D02_orf108 |
g1673944 |
D02_orf108 |
new_conf, predicted metalloenzyme interacting with hemolysin |
  |
  |
  |
MG388 |
  |
  |
new_conf, koonin: zn-dependent enzyme; story; higher order: hemolysin interaction; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP273 |
330453..330779 |
| MPN570 |
complement(691864..692253) |
D02_orf129 |
g1673943 |
D02_orf129 |
conserved hypothetical |
  |
  |
  |
MG389 |
  |
sp: 1..21; cc: 84..109; |
exp: RNA data from ZMBH, RNA-expressed; |
MP272 |
329942..330331 |
| MPN571 |
complement(692255..694237) |
lcnDR3 |
g1673942 |
D02_orf660 |
new_conf, similar to hemolysin ABC-type exporter |
  |
  |
Transporter, ABC family; peptide toxin secretion, probably hemolysin efflux; |
MG390 |
MPN433, MPN193 |
tm: 150..170 188..208 266..286 289..309 402..422; lc: 79..93 473..488 586..601; |
new_conf; story; exp: _BACSU : sublancin exporter; exp: Enterococcus faecalis:hemolysin secretion protein CylB; higher order: neighborhood connection to hymolysin and a GTPase and a hypotetical protein; exp: RNA data from ZMBH, no expression, this is hypothetical; but confirmed by COG1132: ABC-type multidrug/protein/lipid transport system, ATPase component |
MP271 |
327958..329940 |
| MPN572 |
complement(694341..695678) |
D02_orf445 |
g1673940 |
D02_orf445 |
more_, similar to CYTOSOL AMINOPEPTIDASE (LEUCINE AMINOPEPTIDASE) (LAP) |
1-120;hypothetical 121-ct; catalytic |
1BLL-E |
  |
MG391 |
  |
lc: 253..270; |
exp: AMPL_RICPR additonal hypothetical domain 1-120 |
MP270 |
326517..327854 |
| MPN573 |
complement(695692..697323) |
groEL |
g1673939 |
D02_orf543 |
conf, heat shock protein GroEL |
  |
1DER-A |
chaperone |
MG392 |
  |
  |
sub:hsp60 with GroES (MP268) |
MP269 |
324872..326503 |
| MPN574 |
complement(697326..697676) |
groES |
g1673938 |
D02_orf116 |
conf, heat shock protein GroES |
  |
1AON-O |
chaperone |
MG393 |
  |
  |
sub:hsp60 with GroEL (MP269) |
MP268 |
324519..324869 |
| MPN575 |
complement(697864..698250) |
D02_orf128 |
g1673937 |
D02_orf128 |
conserved hypothetical |
  |
  |
  |
  |
  |
tm: 48..68 91..111; |
tm, ?URF exp: RNA data from ZMBH, only low expression twice at 32 degrees, still dubious; |
MP267 |
323945..324331 |
| MPN576 |
complement(698685..699905) |
glyA |
g1673936 |
D02_orf406 |
conf, serine hydroxymethyltransferase |
  |
1TPL-A |
Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid;serine hydroxymethyltransferase (glyA);5,10-methylenetetrahydrofolate + glycine + H2O = tetrahydrofolate + L-serine; |
MG394 |
  |
lc: 381..395; |
exp: Acinetobacter radioresistens |
MP266 |
322290..323510 |
| MPN577 |
complement(700067..701107) |
D02_orf346 |
g1673935 |
D02_orf346 |
see: MP072, conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580 |
lc: 238..250; |
exp: RNA data from ZMBH, only 32 degrees once; |
MP265 |
321088..322128 |
| MPN578 |
701545..701847 |
D02_orf100 |
g1673934 |
D02_orf100 |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
?URF exp: RNA data from ZMBH, RNA-expressed; |
MP264 |
complement(320348..320650) |
| MPN579 |
complement(701863..702192) |
D02_orf109 |
g1673933 |
D02_orf109 |
conserved hypothetical |
  |
  |
  |
  |
MPN350 |
sp: 1..44; tm: 53..73; |
tm, ?URF exp: RNA data from ZMBH, RNA-expressed; |
MP263 |
320003..320332 |
| MPN580 |
complement(702334..702756) |
D02_orf140 |
g1673932 |
D02_orf140 |
see: MP072, conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN589, MPN588, MPN586, MPN584, MPN582, MPN577 |
  |
  |
MP262 |
319439..319861 |
| MPN581 |
complement(702824..703621) |
D02_orf265V |
g1673931 |
D02_orf265V |
see: MP072, conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN590, MPN588, MPN587, MPN586, MPN585, MPN583, MPN582, MPN577 |
  |
  |
MP261 |
318574..319371 |
| MPN582 |
complement(703797..705116) |
D02_orf439 |
g1673930 |
D02_orf439 |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN581, MPN580, MPN577 |
sp: 1..25; |
Less, no further evidence for lipoprotein |
MP260 |
317079..318398 |
| MPN583 |
complement(705554..706231) |
D02_orf225L |
g1673928 |
D02_orf225L |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN588, MPN586, MPN585, MPN582, MPN581, MPN577 |
lc: 32..49; |
  |
MP259 |
315964..316641 |
| MPN584 |
complement(706735..707142) |
D02_orf135L |
g1673927 |
D02_orf135L |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN589, MPN588, MPN586, MPN582, MPN580, MPN577 |
lc: 26..44; |
  |
MP258 |
315053..315460 |
| MPN585 |
complement(707204..708112) |
D02_orf302 |
g1673926 |
D02_orf302 |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN590, MPN588, MPN587, MPN586, MPN583, MPN582, MPN581, MPN577 |
sp: 1..25; |
Less, no further evidence for lipoprotein |
MP257 |
314083..314991 |
| MPN586 |
complement(708186..709229) |
D02_orf347 |
g1673925 |
D02_orf347 |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN589, MPN588, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 |
lc: 72..83 247..263; |
  |
MP256 |
312966..314009 |
| MPN587 |
complement(709105..709557) |
D02_orf150 |
g1673924 |
D02_orf150 |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN590, MPN588, MPN585, MPN582, MPN581, MPN577 |
sp: 1..29; |
exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP255 |
312638..313090 |
| MPN588 |
complement(709615..711210) |
D02_orf531 |
g1673923 |
D02_orf531 |
see: MP072 conserved hypothetical |
  |
  |
  |
MG395 |
MPN084, MPN083, MPN592, MPN591, MPN590, MPN589, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 |
sp: 1..25; lc: 40..54; |
Less, no further evidence for lipoprotein |
MP254 |
310985..312580 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN589 |
complement(711423..711896) |
D02_orf157L |
g1673922 |
D02_orf157L |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN588, MPN586, MPN584, MPN582, MPN580, MPN577 |
  |
  |
MP253 |
310299..310772 |
| MPN590 |
complement(712037..712690) |
D02_orf217L |
g1673921 |
D02_orf217L |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN591, MPN588, MPN587, MPN585, MPN582, MPN581, MPN577 |
sp: 1..31; |
Less, no further evidence for lipoprotein exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP252 |
309505..310158 |
| MPN591 |
complement(712847..713908) |
D02_orf353V |
g1673920 |
D02_orf353V |
see: MP072 conserved hypothetical |
  |
  |
  |
  |
MPN084, MPN083, MPN592, MPN590, MPN589, MPN588, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577, MPN442 |
  |
  |
MP251 |
308287..309348 |
| MPN592 |
complement(714431..715996) |
D02_orf521 |
g1673919 |
D02_orf521 |
conserved hypothetical see: MP072 |
  |
  |
  |
  |
MPN084, MPN083, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 |
sp: 1..25; |
less, tm's; ?URF exp: RNA data from ZMBH, RNA-expressed; note that the orthologue of MG395 is MP254. |
MP250 |
306199..307764 |
| MPN593 |
complement(716097..716465) |
D02_orf122b |
g1673917 |
D02_orf122b |
conserved hypothetical |
  |
  |
  |
  |
MPN085 |
tm: 40..60 74..94; |
tm's; ?URF exp: RNA data from ZMBH, RNA-expressed; |
MP249 |
305730..306098 |
| MPN594 |
complement(716691..717059) |
D02_orf122a |
g1673916 |
D02_orf122a |
conserved hypothetical |
  |
  |
  |
  |
  |
tm: 33..53 86..106; |
tm's; ?URF exp: RNA data from ZMBH, RNA-expressed; |
MP248 |
305136..305504 |
| MPN595 |
complement(716977..717435) |
lacA |
g1673915 |
D02_orf152 |
more__, GALACTOSE-6-PHOSPHATE ISOMERASE AND RIBOSE 5-PHOSPHATE ISOMERASE B; bifunctional |
  |
  |
Energy metabolism, Sugars; galactose-6-phosphate isomerase (if no further subunit is required; D-galactose 6-phosphate = D-tagatose 6-phosphate; bifunctional 2nd function: RIBOSE 5-PHOSPHATE ISOMERASE; D-ribose 5-phosphate = D-ribulose 5-phosphate |
MG396 |
  |
tm: 62..82; |
seems to be able to perform 2 reactions; exp: 44%id RIBOSE 5-PHOSPHATE ISOMERASE B RPIB_ECOLI; exp: 45%id GALACTOSE-6-PHOSPHATE ISOMERASE LACB SUBUNIT (lacA) Rickettsia; also: 41%id galactosidase acetyltransferase (lacA) helicobacter (doubt); sometimes only subunit? |
MP247 |
304760..305218 |
| MPN596 |
complement(717435..719144) |
D02_orf569 |
g1673914 |
D02_orf569 |
conserved hypothetical |
  |
  |
  |
MG397 |
  |
sp: 1..31; cc: 189..215 282..312; lc: 398..410; |
signal sequence; coiled coil; exp: RNA data from ZMBH, RNA-expressed; |
MP246 |
303051..304760 |
| MPN597 |
complement(719144..719545) |
atpC |
g1673913 |
D02_orf133a |
conf, ATP synthase epsilon chain |
  |
1AQT |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG398 |
  |
cc: 88..117; |
sub; exp: ATPE_MYCGA |
MP245 |
302650..303051 |
| MPN598 |
complement(719548..720975) |
atpD |
g1673912 |
D02_orf475 |
conf, ATP synthase beta chain |
  |
1MAB-B |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG399 |
MPN600 |
lc: 149..161; |
sub; exp: ATPB_MYCGA |
MP244 |
301220..302647 |
| MPN599 |
complement(720975..721814) |
atpG |
g1673911 |
D02_orf279 |
conf, ATP synthase gamma chain |
  |
1NBM-G |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG400 |
  |
lc: 270..278; |
sub; exp: ATPG_MYCGA |
MP243 |
300381..301220 |
| MPN600 |
complement(721814..723370) |
atpA |
g1673910 |
D02_orf518 |
conf, ATP synthase alpha chain |
  |
1SKY-B |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG401 |
MPN067, MPN598 |
  |
sub; exp: ATPA_MYCGA |
MP242 |
298825..300381 |
| MPN601 |
complement(723373..723909) |
atpH |
g1673909 |
D02_orf178 |
conf, ATP synthase delta chain |
  |
1ABV |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG402 |
  |
lc: 52..66; |
sub; exp: ATPD_MYCGA |
MP241 |
298286..298822 |
| MPN602 |
complement(723902..724525) |
atpF |
g1673908 |
D02_orf207 |
conf, ATP synthase B chain |
  |
  |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG403 |
  |
sp: 1..31; tm: 50..70; cc: 73..163; |
sub; exp: ATPF_MYCGA ; myco's are 40 longer than all others |
MP240 |
297670..298293 |
| MPN603 |
complement(724528..724845) |
atpE |
g1673907 |
D02_orf105 |
conf, ATP synthase C chain |
  |
  |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG404 |
  |
tm: 33..53; lc: 77..95; |
sub; exp: ATPL_MYCGA |
MP239 |
297350..297667 |
| MPN604 |
complement(724848..725729) |
atpB |
g1673906 |
C12_orf293o |
conf, ATP synthase A chain |
  |
  |
Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; |
MG405 |
  |
tm: 39..59 101..121 128..148 199..219 223..243; |
sub; exp: ATP6_MYCGA |
MP238 |
296466..297347 |
| MPN605 |
complement(725695..726168) |
  |
New identified |
New identified |
conserved hypothetical |
  |
  |
  |
  |
  |
  |
  |
236-237 |
296027..296500 |
| MPN606 |
complement(726174..727544) |
eno |
g1673903 |
C12_orf456 |
conf, enolase (eno) |
  |
1PDY |
Energy metabolism, Glycolysis; enolase; 2-phospho-D-glycerate = phosphoenolpyruvate + H2O; |
MG407 |
MPN120 |
lc: 116..133; |
exp: Nitrosomonas europaea |
MP236 |
294651..296021 |
| MPN607 |
727599..728072 |
pmsR |
g1673902 |
C12_orf157 |
conf, peptide methionine sulfoxide reductase |
  |
  |
  |
MG408 |
MPN197 |
  |
not entirely clear? |
MP235 |
complement(294123..294596) |
| MPN608 |
complement(728069..728746) |
phoU |
g1673901 |
C12_orf225 |
conf, phosphate transport system regulatory protein |
  |
  |
Transporter, ABC superfamily; phosphate transport, regulation; |
MG409 |
  |
  |
phoU negative pho regulator for inorganic phosphate import; exp: Enterobacter cloacae, negative regulatory protein of pho regulon |
MP234 |
293449..294126 |
| MPN609 |
complement(728749..729738) |
pstB |
g1673900 |
C12_orf329 |
conf, phosphate specific |
  |
  |
Transporter, ABC superfamily; phosphate transport, subunit; |
MG410 |
MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 |
cc: 14..40; |
phospahte specific |
MP233 |
292457..293446 |
| MPN610 |
complement(729723..731678) |
pstA |
g1673899 |
C12_orf651V |
conf, Psta /Pstc-like ABC transporter; phosphate specific |
1-230, transporter; 231-410, hypothetical; 411-ct, transporter; |
  |
Transporter, ABC superfamily; phosphate transport, subunit; |
MG411 |
MPN057 |
sp: 1..41; tm: 65..85 114..134 145..165 269..289 369..389 416..436 457..477 486..506 608..628; lc: 547..559; |
dom 231-410 hypothetical; dom 1-230 transporter domain 1 dom 411-ct transporter domain 2 protein seems duplicated compared to others; phosphate specific? |
MP232 |
290517..292472 |
| MPN611 |
complement(731678..732835) |
C12_orf385 |
g1673898 |
C12_orf385 |
new_conf, similar to phosphate binding protein Psts |
  |
1A54-A |
Transporter, ABC superfamily; phosphate transport, subunit; |
MG412 |
  |
sp: 1..38; lc: 47..59; |
new_conf; signal sequence; story: complete phophate uptake there exp: Synechococcus PCC794: regulated by responce regulator, phosphate assimilation; exp: Enterobacter cloacae: inorganic phospahate uptake in chemotaxis; exp: Ecoli: Psts phosphate-binding with high specificity; Bairoch considers this to start shorter, instead of MPVFLKLTHTIRKV he puts a M, than everything is the same LRVARLSRL ...; note recognized yet by swissport P75184; Mikita sees here only one nucleotide overlap with MP232,] MP230 has 241 nts intergenic region. confirmed by updatee COG226, preiplasmic phosphate binding protein; |
MP231 |
289360..290517 |
| MPN612 |
complement(733077..736070) |
C12_orf997 |
g1673897 |
C12_orf997 |
conserved hypothetical |
  |
  |
  |
MG414 |
MPN614, MPN613 |
sp: 1..22; cc: 475..504; |
paralog split MP228, MP229, signal sequence; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; |
MP230 |
286125..289118 |
| MPN613 |
complement(736185..737219) |
C12_orf344 |
g1673896 |
C12_orf344 |
conserved hypothetical |
  |
  |
  |
MG415 |
MPN612 |
tm: 302..322; |
part of paralog MP230; ?URF; exp: RNA data from ZMBH, this is hypothetical, no expression; |
MP229 |
284976..286010 |
| MPN614 |
complement(737155..738159) |
C12_orf334 |
g1673895 |
C12_orf334 |
conserved hypothetical see: MP230 |
  |
  |
  |
  |
MPN612 |
sp: 1..22; |
part of paralog MP230, signal sequence; ?URF; exp: RNA data from ZMBH only expressed at 32 degress, RNA-expressed; |
MP228 |
284036..285040 |
| MPN615 |
complement(738245..738994) |
hsdS |
g1673894 |
C12_orf249 |
conf,see: MP335 |
  |
  |
  |
  |
MPN089, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201 |
  |
sub; family, see main representative MP335 |
MP227 |
283201..283950 |
| MPN616 |
complement(739424..739822) |
rpsI |
g1673892 |
C12_orf132 |
conf, ribosomal protein S9 |
  |
  |
  |
MG417 |
  |
  |
SUB; |
MP226 |
282373..282771 |
| MPN617 |
complement(739828..740268) |
rplM |
g1673891 |
C12_orf146 |
conf, ribosomal protein L13 |
  |
  |
  |
MG418 |
  |
  |
SUB; |
MP225 |
281927..282367 |
| MPN618 |
complement(740299..742344) |
dnaX |
g1673890 |
C12_orf681 |
more__, gamma-like |
  |
1A5T |
  |
MG419; MG420 |
MPN007, MPN452 |
lc: 598..611 643..653; |
DNA polymerase III gamma has usually only 270aa; also domain insertion compared to MG; gamma is usually part of tau, but tau and homologs are only 440aa long ???; sub: DNA polymerase III |
MP224 |
279851..281896 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN619 |
complement(742353..745199) |
uvrA |
g1673889 |
C12_orf948L |
conf, excinuclease ABC subunit A |
  |
  |
  |
MG421 |
MPN685, MPN609, MPN432, MPN258, MPN194, MPN193 |
  |
_neigo; sub A; exp: RNA data from ZMBH only 32 degree and very low, doubtful whether really expressed; |
MP223 |
276996..279842 |
| MPN620 |
complement(745177..747696) |
C12_orf839 |
g1673888 |
C12_orf839 |
conserved hypothetical |
  |
  |
  |
MG422 |
  |
cc: 257..288 344..373 646..672; lc: 603..618 767..783; |
?maturase-like; paralog of MP246? hit to euglen; exp: RNA data from ZMBH, only 32 degree once, doubtful |
MP222 |
274499..277018 |
| MPN621 |
complement(747742..749427) |
C12_orf561 |
g1673887 |
C12_orf561 |
new_conf, similar to metallo hydrolase |
  |
1BC2-A |
  |
MG423 |
MPN280 |
  |
paralog of MP555 (metallo hydrolase (incl. sulfatases, some b-lactamases); Archaeoglobus: mRNA 3' -end processing factor; Methanobacterium thermoautotrophicum: cleavage and polyadenylation specificity factor (taken from Bos taurus); metallo hydrolase described described in Galperin ,M.Y. et al.Protein Sci 1998 Aug;7(8):1829-35; COG0595; new_add: but participation in mRNA 3'-processing appears likely and can be added. |
MP221 |
272768..274453 |
| MPN622 |
complement(749432..749692) |
rpsO |
g1673886 |
C12_orf86 |
conf, ribosomal protein S15 |
  |
1AB3 |
  |
MG424 |
  |
  |
SUB; exp: _bacst |
MP220 |
272503..272763 |
| MPN623 |
749850..751202 |
deaD |
g1673885 |
C12_orf450 |
conf, similar to ATP-dependent RNA helicase deaD |
  |
1A1V-A |
  |
MG425 |
MPN443 |
  |
exp: _ecoli can suppress a mutation in rpsB, the gene encoding ribosomal protein S2; exp: involved inAutoaggregation of Lactobacillus reuteri |
MP219 |
complement(270993..272345) |
| MPN624 |
751224..751421 |
rpmB |
g1673884 |
C12_orf65 |
conf, ribosomal protein L28 |
  |
  |
  |
MG426 |
  |
  |
SUB; required for sporulation by Bacillus subtilis; exp: _bacst |
MP218 |
complement(270774..270971) |
| MPN625 |
751465..751890 |
C12_orf141 |
g1673883 |
C12_orf141 |
new, osmotical inducible protein C like family; inducable by osmotic stress and by organic hydroperoxides |
  |
  |
  |
MG427 |
  |
lc: 42..57; |
new; large family via pyrococcus hit; exp: _ecoli OSMOTICALLY INDUCIBLE PROTEIN C; exp: Xanthomonas campestris J. Bacteriol. 180 (10), 2636-2643 (1998);highly induced by organic hydroperoxides andweakly induced by H2O2, and not induced at all by a superoxide generator ; paralog of MP174; J. Mol. Biol. 220 (4), 959-973 (1991); |
MP217 |
complement(270305..270730) |
| MPN626 |
752025..752543 |
C12_orf172 |
g1673881 |
C12_orf172 |
conserved hypothetical |
  |
  |
  |
MG428 |
  |
  |
  |
MP216 |
complement(269652..270170) |
| MPN627 |
complement(752540..754258) |
ptsI |
g1673880 |
C12_orf572 |
conf, PEP-dependent HPr protein kinase phosphoryltransferase (Enzyme I) |
  |
1BUK, 1ZYM-B |
Transporter, general PTS component; |
MG429 |
  |
lc: 510..516 555..568; |
sub; exp: _mycca |
MP215 |
267937..269655 |
| MPN628 |
complement(754263..755789) |
pgm |
g1673879 |
C12_orf508 |
conf, phosphoglycerate mutase |
  |
1AJA-A |
Energy metabolism, Glycolysis; phosphoglycerate mutase (pgm); glyceraldehyde 3-phosphate = glyceraldehyde 2-phosphate |
MG430 |
  |
  |
exp: Bacillus megaterium |
MP214 |
266406..267932 |
| MPN629 |
complement(755782..756516) |
tim |
g1673878 |
C12_orf244 |
conf, triosephosphate isomerase |
  |
1AW1-A |
Energy metabolism, Glycolysis; triosephosphate isomerase (tim); glyceraldehyde 3-phosphate = dihydroxyacetone phosphate |
MG431 |
  |
  |
exp: Clostridium acetobutylicum |
MP213 |
265679..266413 |
| MPN630 |
complement(756569..757783) |
yfiB |
g1673877 |
C12_orf404 |
conserved hypothetical |
  |
  |
  |
MG432 |
MPN657 |
tm: 37..57 94..114 120..140 188..208 230..250 278..298; lc: 386..401; |
tm, large family, also in Mp several members.. permease? exp: RNA data from ZMBH, no expression (lower than 160), this is hypothetical ! |
MP212 |
264412..265626 |
| MPN631 |
757870..758766 |
tsf |
g1673876 |
C12_orf298 |
conf, elongation factor Ts |
  |
1EFU-B |
  |
MG433 |
  |
  |
exp: _spiri |
MP211 |
complement(263429..264325) |
| MPN632 |
758768..759475 |
pyrH |
g1673875 |
C12_orf235 |
conf, uridylate kinase |
  |
  |
Purines, pyrimidines, nucleosides and nucleotides, Nucleotide and nucleoside interconversions. uridylate kinase (pyrH); ATP + UMP = ADP + UDP; |
MG434 |
  |
lc: 43..52; |
exp: _ecoli |
MP210 |
complement(262720..263427) |
| MPN633 |
759578..760321 |
C12_orf247 |
g1673874 |
C12_orf247 |
conserved hypothetical see: MP207 |
  |
  |
  |
  |
MPN635 |
lc: 234..246; |
part of a 352aa MP paralog (MP207); ?URF; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP209 |
complement(261874..262617) |
| MPN634 |
760403..760948 |
C12_orf181o |
g1673873 |
C12_orf181o |
conserved hypothetical see: MP207 |
  |
  |
  |
  |
MPN635 |
  |
part of a 352aa MP paralog (MP207) ?URF |
MP208 |
complement(261247..261792) |
| MPN635 |
761504..762562 |
E30_orf352 |
g1673872 |
E30_orf352 |
conserved hypothetical |
  |
  |
  |
  |
MPN634, MPN633 |
lc: 218..230; |
duplicated within MP and split into 2 (MP208, MP209); exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP207 |
complement(259633..260691) |
| MPN636 |
762639..763193 |
frr |
g1673870 |
E30_orf184 |
conf, ribosome releasing factor |
  |
  |
  |
MG435 |
  |
cc: 153..179; |
SUB; |
MP206 |
complement(259002..259556) |
| MPN637 |
763193..764380 |
cdsA |
g1673869 |
E30_orf395 |
conf, CDP-diglyceride synthetase |
1-95 no hit 96-ct |
  |
Fatty acid and phospholipid metabolism; CDP-diglyceride synthetase (cdsA); CTP + phosphatidate = pyrophosphate + CDP-diacylglycerol; |
MG437 |
MPN057 |
sp: 1..35; tm: 77..97 115..135 148..168 178..198 201..221 241..261 308..328 360..380; |
hits eukaryotic phosphatidate cytidylyltransferases; integral membrane protein with >6tm (9 an notated, rat 6, Nt95aa no match) homology starts pos 150 (might be longer); exper:_drome _arath _soltu |
MP205 |
complement(257815..259002) |
| MPN638 |
764400..765527 |
E30_orf375 |
g1673868 |
E30_orf375 |
new_conf, specificity determining subunit for restriction enzyme belonging to the K family of S proteins |
  |
  |
  |
MG438 |
MPN089, MPN285 |
lc: 23..35; |
sub, 3 domains described, but boundaries not clear; annotated for MG; Koonin said before cc, latest COG version 0732 confirms S subunit for restriction enzymes |
MP204 |
complement(256668..257795) |
| MPN639 |
complement(765524..766387) |
E09_orf287o |
g1673867 |
E09_orf287o |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN012, MPN654, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..29; |
less; exp: RNA data from ZMBH, only 32 degrees, RNA-expressed; Bairoch: Gene start at aa5, so at MALKLR... Mikita noticed some overlap with MP204 |
MP203 |
255808..256671 |
| MPN640 |
complement(766395..767297) |
E09_orf300 |
g1673866 |
E09_orf300 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN639 |
sp: 1..22; lc: 177..190; |
less exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP202 |
254898..255800 |
| MPN641 |
complement(767297..768127) |
E09_orf276 |
g1673865 |
E09_orf276 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..29; |
less; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP201 |
254068..254898 |
| MPN642 |
complement(768130..768969) |
E09_orf279 |
g1673864 |
E09_orf279 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN641, MPN640, MPN639 |
sp: 1..18; lc: 21..33; |
less; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP200 |
253226..254065 |
| MPN643 |
complement(768969..769877) |
E09_orf302 |
g1673863 |
E09_orf302 |
conserved hypothetical |
  |
  |
  |
MG440 |
MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN644, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
lc: 123..133; |
less (and so for all the homologues) because in MG it is claimed that this is a putative lipoprotein - there is no evidence for this (Sternberg thinks to of a putative lipoprotein); exp: RNA data from ZMBH only at 32 degress; Mikita did see an overlap of -80 nts with MP198 and so does new_conf Bairoch: The real start is MKKKIWNKTS ... |
MP199 |
252318..253226 |
| MPN644 |
complement(769798..770649) |
E09_orf283b |
g1673862 |
E09_orf283b |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN654, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..30; |
less; exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP198 |
251546..252397 |
| MPN645 |
complement(770652..771503) |
E09_orf283a |
g1673861 |
E09_orf283a |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639 |
sp: 1..25; |
less;exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP197 |
250692..251543 |
| MPN646 |
complement(771503..772336) |
E09_orf277 |
g1673860 |
E09_orf277 |
conserved hypothetical see: MP199 |
  |
  |
  |
  |
MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..27; |
less; exp: RNA data from ZMBH, RNA-expressed; |
MP196 |
249859..250692 |
| MPN647 |
complement(772359..773231) |
E09_orf290 |
g1673859 |
E09_orf290 |
conserved hypothetical see: MP199 |
  |
  |
  |
MG439 |
MPN654, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..24; |
less; exp: RNA data from ZMBH, RNA-expressed; |
MP195 |
248964..249836 |
| MPN648 |
complement(773342..773752) |
E09_orf136 |
g1673858 |
E09_orf136 |
conserved hypothetical |
  |
  |
  |
MG441 |
MPN212 |
sp: 1..41; |
further homolog in MP Y074; exp: RNA data from ZMBH only at 32 degrees, RNA-expressed; |
MP194 |
248443..248853 |
| MPN |
Position |
Gene |
GI |
Orf |
Annotation |
Domain |
Structure |
Pathway |
MG Ortholog |
MP Homolog |
Intrinsics |
Comments |
MP_old |
MP_old_Position |
| MPN649 |
complement(774639..775049) |
E09_orf136L |
g1673857 |
E09_orf136L |
hypothetical see: MP199 |
  |
  |
  |
  |
MPN148, MPN054, MPN012, MPN011, MPN646, MPN643, MPN641, MPN639, MPN505, MPN466, MPN411, MPN369, MPN271 |
  |
less;exp: RNA data from ZMBH, no expression, this is hypothetical ! |
MP193 |
247146..247556 |
| MPN650 |
complement(775034..775339) |
E09_orf101 |
g1673856 |
E09_orf101 |
hypothetical see: MP199 |
  |
  |
  |
  |
MPN054, MPN012, MPN011, MPN654, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..22; |
less; exp: RNA data from ZMBH, RNA-expressed; |
MP192 |
246856..247161 |
| MPN651 |
776337..777476 |
mtlA |
g1673855 |
E09_orf379 |
less, similar to mannitol-specific PRS EIIBC |
  |
  |
transporter, PTS; sugar transport, mannitol, component IIBC; |
  |
MPN078 |
tm: 38..58 123..143 167..187 195..215 226..246; |
sub, wrong annotation, >4 tm regions according to Reizer can framshift lead to complete BC; exp: RNA data from ZMBH, no expression, this is hypothetical !MP191-192 (<-->) 997 N-term of MP191 # frame shift between 245982-246018 (2 base missing?) # Function: PTS EIIBC (C-, B-domains) |
MP191 |
complement(244719..245858) |
| MPN652 |
777463..778557 |
mtlD |
g1673854 |
E09_orf364 |
conf, mannitol-1-phosphate 5-dehyrogenase (EC 1.1.1.17) |
4-341, Mannitol_dh (Pfam) |
  |
Energy metabolism, Sugars; mannitol-1-phosphate 5-dehydrogenase; D-mannitol 1-phosphate + NAD(+) = D-fructose 6-phosphate + NADH; note that MP189 and MP191 turn mannitol into mannitol1P; this enzyme turns it than into fructose 6-phosphate, direct link to glycolysis; |
  |
  |
  |
  |
MP190 |
complement(243638..244732) |
| MPN653 |
778538..778969 |
mtlF |
g1673853 |
E09_orf143V |
conf, PTS system mannitol-specific component IIA (EIIA-MTL) |
  |
1A3A-A |
transporter, PTS; mannitol specific component IIA; see MP191 for component IIBC; |
  |
  |
  |
exp:_bacillus stearothermophilus, 96421984; Paulsen: PTS, mannitol |
MP189 |
complement(243226..243657) |
| MPN654 |
complement(779342..779731) |
E09_orf129 |
g1673851 |
E09_orf129 |
conserved hypothetical, see: MP199 |
  |
  |
  |
  |
MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 |
sp: 1..33; |
  |
MP188 |
242464..242853 |
| MPN655 |
780008..780622 |
E09_orf204o |
g1673850 |
E09_orf204o |
hypothetical see: MP141 |
  |
  |
  |
  |
, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 |
cc: 125..201; lc: 62..96; |
URF; exp: RNA data from ZMBH, RNA-expressed; |
MP187 |
complement(241573..242187) |
| MPN656 |
complement(781095..781910) |
K05_orf271 |
g1673849 |
K05_orf271 |
new_conf, similar to GTP-binding protein |
  |
  |
  |
MG442 |
MPN008, MPN568, MPN481, MPN475 |
  |
new_conf Koonin: GTPase; unconnected; this is only once expressed low (345) at degrees, perhaps also hypothetical; |
MP186 |
240285..241100 |
| MPN657 |
complement(781879..783084) |
K05_orf401 |
g1673848 |
K05_orf401 |
conserved hypothetical |
  |
  |
  |
MG443 |
MPN630 |
tm: 46..66 101..121 133..153 208..228 251..271 291..311; |
exp: RNA data from ZMBH, only once low (198, close to background) expression at 32, degrees, this is hypothetical ! |
MP185 |
239111..240316 |
| MPN658 |
complement(783100..783459) |
rplS |
g1673847 |
K05_orf119 |
conf, ribosomal protein L19 |
  |
  |
  |
MG444 |
  |
  |
SUB; |
MP184 |
238736..239095 |
| MPN659 |
complement(783443..784075) |
trmD |
g1673846 |
K05_orf210 |
conf, tRNA (guanine-N1)-methyltransferase |
  |
  |
  |
MG445 |
  |
  |
  |
MP183 |
238120..238752 |
| MPN660 |
complement(784141..784407) |
rpsP |
g1673845 |
K05_orf88 |
conf, ribosomal protein S16 |
  |
  |
  |
MG446 |
  |
  |
SUB; |
MP182 |
237788..238054 |
| MPN661 |
complement(784489..786138) |
K05_orf499 |
g1673844 |
K05_orf499 |
conserved hypothetical |
  |
  |
  |
MG447 |
  |
tm: 58..78 96..116 183..203 210..230 252..272 303..323 349..369 388..408 420..440 451..471; |
exp: RNA data from ZMBH, at 32 degrees 2x; RNA-expressed; |
MP181 |
236207..237706 |
| MPN662 |
complement(786139..786594) |
pilB |
g1673843 |
K05_orf151 |
conserved hypothetical |
  |
  |
  |
MG448 |
  |
  |
similar to the c-term. non catalytic part of sulfoxide reductases don't know, what pilB means exp: RNA data from ZMBH, RNA-expressed; |
MP180 |
235601..236056 |
| MPN663 |
complement(786558..787262) |
K05_orf234 |
g1673842 |
K05_orf234 |
conserved hypothetical |
  |
1PYS-B |
  |
MG449 |
MPN106 |
  |
similar to a part of tRNA-synthetase probably nucleic-binding exp: RNA data from ZMBH, RNA-expressed; |
MP179 |
234933..235637 |
| MPN664 |
complement(787269..787982) |
degV |
g1673841 |
K05_orf237 |
conserved hypothetical |
  |
  |
  |
MG450 |
MPN472 |
lc: 163..181; |
exp: RNA data from ZMBH, RNA-expressed; |
MP178 |
234213..234926 |
| MPN665 |
complement(788141..789325) |
tuf |
g1673840 |
K05_orf394 |
conf, elongation factor TU |
  |
1EFT |
  |
MG451 |
MPN279, MPN227, MPN155 |
lc: 222..236; |
sub: translation |
MP177 |
232870..234054 |
| MPN666 |
789410..790165 |
K05_orf251 |
g1673838 |
K05_orf251 |
conserved hypothetical |
  |
  |
  |
MG452 |
MPN274 |
sp: 1..38; tm: 85..105 120..140 156..176 206..226; |
exp: RNA data from ZMBH shows no expression, this is hypothetical ! |
MP176 |
complement(232030..232785) |
| MPN667 |
790153..791028 |
gtaB |
g1673837 |
K05_orf291 |
conf, UDP-glucose pyrophosphorylase |
  |
  |
Purines, pyrimidines, nucleosides and nucleotides, Sugar-nucleotide biosynthesis and conversions; UDP-glucose pyrophosphorylase; UTP + Glucose 1-Phosphate = PPi + UDP-Glucose |
MG453 |
  |
  |
  |
MP175 |
complement(231167..232042) |
| MPN668 |
complement(791025..791447) |
osmC |
g1673836 |
K05_orf140 |
conserved hypothetical |
  |
  |
  |
MG454 |
  |
  |
gb-entry tells nothing about the function |
MP174 |
230748..231170 |
| MPN669 |
791473..792672 |
tyrS |
g1673835 |
K05_orf399 |
conf, tyrosyl tRNA synthetase |
  |
1TYA-E |
  |
MG455 |
  |
lc: 281..293; |
  |
MP173 |
complement(229523..230722) |
| MPN670 |
complement(792712..793749) |
K05_orf345 |
g1673834 |
K05_orf345 |
conserved hypothetical |
  |
  |
  |
MG456 |
  |
sp: 1..41; tm: 52..72; lc: 312..331; |
exp: RNA data from ZMBH, RNA-expressed; |
MP172 |
228446..229483 |
| MPN671 |
complement(794302..796431) |
ftsH |
g1673833 |
K05_orf709 |
conf, cell division protein FtsH |
  |
1D2N-A |
  |
MG457 |
MPN536 |
sp: 1..42; tm: 173..193; cc: 672..702; lc: 641..656; |
  |
MP171 |
225764..227893 |
| MPN672 |
complement(796612..797139) |
hpt |
g1673832 |
K05_orf175 |
conf, hypoxanthine-guanine phosphoribosyltransferase |
  |
1HGX-B |
Nucleotide and deoxynucleotide degradation or rescue reaction. hypoxanthine-guanine phosphoribosyltransferase; Inosine monophosphate + pyrrophosphate = hypoxanthine + phosphoribosylpyrrophospate; note: Guanine and 6-mercaptopurine can replace hypoxanthine; |
MG458 |
  |
  |
  |
MP170 |
225056..225583 |
| MPN673 |
complement(797139..797648) |
K05_orf169 |
g1673831 |
K05_orf169 |
conserved hypothetical |
  |
  |
  |
MG459 |
MPN041 |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP169 |
224547..225056 |
| MPN674 |
797819..798757 |
ldh |
g1673830 |
K05_orf312 |
conf, L-lactate dehydrogenase |
  |
2LDX |
Energy metabolism, Aerobic; L-lactate dehydrogenase (ldh); lactate + NAD = pyruvate + NADH; |
MG460 |
  |
sp: 1..21; |
homotetramer |
MP168 |
complement(223438..224376) |
| MPN675 |
complement(799162..799467) |
K05_orf101a |
g1673829 |
K05_orf101a |
hypothetical see: MP141 |
  |
  |
  |
  |
MPN151, MPN145, MPN139, MPN137, MPN127, MPN038, MPN010, MPN504, MPN484, MPN344, MPN287 |
  |
exp: RNA data from ZMBH, RNA-expressed; |
MP167 |
222728..223033 |
| MPN676 |
799858..800178 |
K05_orf106 |
g1673828 |
K05_orf106 |
hypothetical see: MP376 |
  |
  |
  |
  |
MPN037, MPN465 |
lc: 7..21; |
MP specific exp: RNA data from ZMBH, RNA-expressed; |
MP166 |
complement(222017..222337) |
| MPN677 |
complement(800735..802012) |
K05_orf425 |
g1673826 |
K05_orf425 |
new_conf, similar to ATPases |
  |
  |
  |
MG461 |
  |
  |
new_conf Koonin zn-dependent protease; unconnected |
MP165 |
220183..221460 |
| MPN678 |
complement(801993..803447) |
gltX |
g1673825 |
K05_orf484 |
conf, glutamyl-tRNA synthetase |
  |
1GLN |
  |
MG462 |
  |
cc: 388..414; |
  |
MP164 |
218748..220202 |