Bork Team

Genome Re-Annotation for M. pneumoniae:
The complete annotation table

EMBL@Heidelberg
The NAR publication of this work.

The old working table for the MP reannotation
MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN001 692..1834 dnaN g1673814 K05_orf380 conf, DNA polymerase III beta subunit   2POL-A cell division MG001   lc: 2..22; sub: DNA polymerase III MP153 complement(203967..205109)
MPN002 1838..2767 xdj1 g1673813 K05_orf309 more__, similar to j-domain of DnaJ 1-77, j-domain of DnaJ; rest only homologs MP/MG 1HDJ cell division (?) cochaperon (?) possible activation of DnaK MG002 MPN119, MPN048, MPN021   sub: heat_shock (I); needs DNAK; caution! may be it is not at all working as DnaJ; new_conf known for MG homolog 94364962 J Bacteriol 1994 Sep 176:18 5814-9 "contains a DnaJ box motif at its N terminus, but it has no overall homology to any other protein or sequence in the database"; unconnected; less: not a DnaJ but likely to activate DnaK as it contains the j-domain of DnaJ; exp: 94149015 _ECOLI; By position (between dnaN and gyrB, a position where recF - not present in MP - normally seats) it maybe transcribed together with cell division proteins and therefore it must have a related functional role. MP152 complement(203034..203963)
MPN003 2869..4821 gyrB g1673811 K05_orf650 conf, DNA gyrase subunit B   1BGW, 1AJ6 cell division MG003 MPN122 lc: 395..407; sub: DNA gyrase MP151 complement(200980..202932)
MPN004 4821..7340 gyrA g1673810 K05_orf839o conf, DNA gyrase subunit A   1AB4 cell division MG004 MPN123 cc: 1..25 445..487; lc: 709..722 752..765 816..829; sub: DNA gyrase MP150 complement(198461..200980)
MPN005 7312..8574 serS g1673809 D12_orf420 conf, seryl-tRNA synthetase   1SER-A   MG005   cc: 66..99; exp:_ecoli, 87146412 MP149 complement(197227..198489)
MPN006 8579..9211 D12_orf210 g1673808 D12_orf210 conf, thymidylate kinase   1TMK-A Nucleotide and deoxynucleotide degradation or rescue reaction; thymidylate kinase; NTP + Thymidin = NDP + TMP. MG006     exp:_yeast, 84289538 MP148 complement(196590..197222)
MPN007 9184..9945 holB g1673807 D12_orf253 less, similar to DNA-polymerase subunits   1A5T   MG007 MPN618 lc: 178..191; sub: DNA polymerase III; less, no sufficient significance for subunit delta prime; MP147 complement(195856..196617)
MPN008 9947..11275 thdF g1673806 D12_orf442 conf, thiophene and furan oxidation protein   1EFT   MG008 MPN656, MPN568, MPN481, MPN475   exp:_ecoli, 92011358 MP146 complement(194526..195854)
MPN009 11275..12060 yabD g1673805 D12_orf261 new_conf, hydrolase       MG009     new_conf Koonin: metal utilizing enzyme (homolog MG) similar to other hydrolases; unconnected; is really hypothetical, RNA data from ZMBH, no expression in 3 diff experiments, not expressed; MP145 complement(193741..194526)
MPN010 12257..12652 D12_orf131 g1673804 D12_orf131 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF; exp: RNA data from ZMBH, RNA-expressed; MP144 complement(193149..193544)
MPN011 complement(12838..13533) D12_orf231 g1673803 D12_orf231 conserved hypothetical see: MP199         MPN148, MPN054, MPN012, MPN654, MPN650, MPN649, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN271, MPN173 sp: 1..22;   MP143 192268..192963
MPN012 complement(13558..14265) D12_orf235 g1673802 D12_orf235 conserved hypothetical see: MP199         MPN148, MPN054, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN271 sp: 1..21;   MP142 191536..192243
MPN013 14992..15765 D12_orf257 g1673801 D12_orf257 hypothetical         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 199..255; lc: 67..91 97..114; Note that this whole family occurs only in M.pneumoniae, it is the DUF16 family (pfam); so it is not conserved between species, only occurs in different homologues in M.pneumoniae exp: RNA data from ZMBH, RNA-expressed; MP141 complement(190036..190809)
MPN014 15867..16505 dnaE g1673800 D12_orf212 conserved hypothetical       MG010 MPN353   only similar to the middle part of DNA-primase MP; exp: RNA data from ZMBH found only once at 32 degrees an mRNA, doubtful; MP140 complement(189296..189934)
MPN015 complement(16482..17339) D12_orf285 g1673799 D12_orf285 conserved hypothetical   1JDB-B   MG011 MPN016   similar to MP138 MP139 188462..189319
MPN016 complement(17339..18205) rimK g1673798 D12_orf288 conf, similar to ribosomal S6 modification protein   1JDB-B   MG012 MPN015   SUB; similar to ribosomal S6 modification protein ECOLI (89364710) MP138 187596..188462
MPN017 complement(18180..18989) mtd1 g1673797 D12_orf269 conf, 5,10-methylene-tetrahydrofolate dehydrogenase     Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; 5,10-methylene-tetrahydrofolate dehydrogenase; 5,10-methylenetetrahydrofolate + NAD(P) = 5,10-methenyltetrahydrofolate + NAD(P)H MG013   lc: 146..156; homodimer; biosynthesis MP137 186812..187621
Ala-tRNA(GCA) complement(19074..19149)       in Genbank, "gene" missing. Maybe gene = "mptgi"               complement(19074..19149) 186652..186727
Ile-tRNA(ATC) complement(19155..19231) mptgi                     complement(19155..19231) 186570..186646
MPN018 19325..21196 pmd1 g1673795 D12_orf623 conf, transport ATP-binding protein 16-315, ABC_membrane (Pfam) 393-587, ABC_tran (Pfam)   Transporter, ABC superfamily; drug efflux MG014 MPN134, MPN081, MPN055, MPN019, MPN685, MPN683, MPN609, MPN433, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 sp: 1..25; tm: 31..51 84..104 181..201 267..287 312..332; lc: 476..493; Paulsen: ABC superfamily, membrane, drug efflux MP136 complement(184605..186476)
MPN019 21108..23012 msbA g1673794 D12_orf634 conf, transport ATP-binding protein 54-345, ABC_membrane (Pfam) 423-607, ABC_tran (Pfam)   Transporter, ABC superfamily; drug efflux MG015 MPN134, MPN081, MPN055, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 tm: 54..74 111..131 190..210 213..233 293..313 325..345; Paulsen: ABC superfamily, membrane, drug efflux MP135 complement(182789..184693)
MPN020 23022..26114 yb95 g1673793 D12_orf1030 conf, similar to helicases 581-848, SNF2_N (Pfam) 892-975, helicase_C (Pfam) 1A1V-A   MG016; MG017; MG018     exp: RNA data from ZMBH, 2x at 32 degrees, RNA-expressed; MP134 complement(179687..182779)
MPN021 26160..27332 dnaJ g1673792 D12_orf390o conf, heat shock protein DnaJ   1HDJ cochaperon; activator of DnaK MG019 MPN119, MPN002 lc: 262..275; sub:hsp70 with DnaK (MP407) and GrpE (MP034) MP133 complement(178469..179641)
MPN022 27316..28245 pip g1673791 B01_orf309 conf, proline iminopeptidase   1BE0   MG020     exp:_neigo, 95020651 MP132 complement(177556..178485)
MPN023 28245..29783 metS g1673790 B01_orf512 conf, methionyl-tRNA synthetase   1GLN   MG021 MPN520, MPN480, MPN384   homodimer; translation MP131 complement(176018..177556)
MPN024 29804..30244 rpoE g1673789 B01_orf146 conf, DNA-directed RNA polymerase delta subunit       MG022     sub: transcription; exp:_bacsu, 88329737 MP130 complement(175557..175997)
MPN025 30244..31110 tsr g1673788 B01_orf288 conf, fructose-bisphosphate aldolase   1DOS-A Energy metabolism, Glycolysis; fructose-bisphosphate aldolase; fructose 1,6-bisphosphate = glycerone phosphate + D-glyceraldehyde 3-phosphate; MG023     homodimer MP129 complement(174691..175557)
MPN026 31111..32199 yyaF g1673787 B01_orf362 new_conf, similar to GTPases   1DAR   MG024 MPN563 lc: 186..195; new_conf Koonin: GTPase; unconnected; exp: RNA data from ZMBH, RNA-expressed; MP128 complement(173602..174690)
MPN027 complement(32202..33026) B01_orf274 g1673786 B01_orf274 hypothetical             This protein has no relatives. exp: RNA data from ZMBH, RNA-expressed; Is is suggested (Ake Wieslaender, university of Stockholm) that this protein tentatively may be some kind of transcription regulator MP127 172775..173599
MPN028 33059..33958 trsB g1673785 B01_orf299V conf, sugar transferase       MG025 MPN075, MPN483, MPN238   probable beta-glycosyltransferase trsB - Yersinia enterocolitica was meant with the old assignment; would easy lead to a wrong_ Koonin: similar to RfbV (enzyme?) trsb may however have no meaning for non-specialist or leads in completely other directions (trsb gene in virusses or for recombination) MP126 complement(171843..172742)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN029 33979..34551 efp g1673784 B01_orf190 conf, elongation factor P   1BKB   MG026     sub: translation; MP125 complement(171250..171822)
MPN030 34469..34975 B01_orf168 g1673783 B01_orf168 conserved hypothetical       MG027   sp: 1..20;   MP124 complement(170826..171332)
MPN031 34975..35586 B01_orf203 g1673782 B01_orf203 conserved hypothetical       MG028   sp: 1..29; tm: 42..62 86..106 127..147; exp: RNA data from ZMBH, but only once at 32 degree, remain sceptical. MP123 complement(170215..170826)
MPN032 complement(35810..36136) B01_orf108 g1673781 B01_orf108 new_conf, hydrolase   1IPH-A   MG029     new_conf, similar to other hydrolases exp:_pyrfu; exp: RNA data from ZMBH, RNA-expressed; latest versioin of COG693 suggsests a protease/amidase; hydrolase is meant as being less specific on the function, protease is not sure by the sequence evidence, but plausible. MP122 169665..169991
MPN033 complement(36140..36760) upp g1673780 B01_orf178 conf, uracil phosphoribosyltransferase     Purines, pyrimidines, nucleosides and nucleotides; Salvage of nucleosides and nucleotides; uracil phosphoribosyltransferase; UMP + pyrrophosphatete = Uracile + phosphoribosylpyrrophosphate.. MG030 MPN073 tm: 96..116; new compared to Bairoch: In P75081 still considered to start at MALSQITSLL ...; but now updated, 15.2.2000; MP121 169125..169661
MPN034 complement(36800..41131) polC g1673778 B01_orf1443 conf, DNA polymerase III (dnaE) alpha chain       MG031 MPN378   sub: DNA polymerase III; MP120 164670..169001
MPN035 41409..43409 B01_orf666 g1673777 B01_orf666 conserved hypothetical see: MP118         MPN049, MPN048, MPN042, MPN041, MPN039, MPN036, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 sp: 1..22; cc: 323..371; exp: No expression (3 measurements), is not expressed ! MP119 complement(162392..164392)
MPN036 43581..45602 B01_orf673 g1673776 B01_orf673 conserved hypothetical       MG032 MPN049, MPN048, MPN042, MPN041, MPN039, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 sp: 1..30; cc: 313..376; lc: 130..143; exp: RNA data from ZMBH, RNA-expressed; MP118 complement(160199..162220)
MPN037 45770..46213 B01_orf147 g1673775 B01_orf147 hypothetical see: MP376         MPN676, MPN465 tm: 11..31 40..60 75..95; lc: 133..145; MP specific exp: RNA data from ZMBH, RNA-expressed; MP117 complement(159588..160031)
MPN038 complement(46442..46792) B01_orf116L g1673774 B01_orf116L hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF exp: RNA data from ZMBH, RNA-expressed; MP116 159009..159359
MPN039 47194..48210 B01_orf338 g1673773 B01_orf338 conserved hypothetical see: MP118         MPN049, MPN048, MPN042, MPN036, MPN035, MPN512, MPN510, MPN509, MPN508, MPN234 sp: 1..23; exp: RNA data from ZMBH, RNA-expressed; MP115 complement(157591..158607)
MPN040 complement(48105..48416) B01_orf103b g1673772 B01_orf103b conserved hypothetical           sp: 1..45; lc: 46..75; URF exp: RNA data from ZMBH, RNA-expressed; MP114 157385..157696
MPN041 48670..49230 B01_orf186L g1673771 B01_orf186L conserved hypothetical see: MP118         MPN049, MPN048, MPN042, MPN036, MPN035, MPN673, MPN511, MPN510, MPN509, MPN508   exp: RNA data from ZMBH, RNA-expressed; MP113 complement(156571..157131)
MPN042 49292..51310 B01_orf672 g1673769 B01_orf672 conserved hypothetical see: MP118         MPN049, MPN048, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 sp: 1..28; cc: 102..125 319..366; exp: RNA data from ZMBH, RNA-expressed; MP112 complement(154491..156509)
MPN043 51634..52428 glpF g1673768 B01_orf264 conf, glycerol uptake facilitator     transporter, ion channels; note that this can also transport e.g. urea and polyols; MG033   tm: 13..33 49..69 102..122 165..185 193..213; Paulsen: Ion channel, MIP, glycerol MP111 complement(153373..154167)
MPN044 complement(52475..53050) tdk g1673767 B01_orf191 conf, thymidine kinase     Purines, pyrimidines, nucleosides and nucleotides; Salvage of nucleosides and nucleotides; thymidine kinase; ATP + thymidine = ADP + thymidine5Phosphate. MG034     exp: 2D-Gel data from ZMBH Ges., MW 24kD, IEP ca. 8.9 MP110 152751..153326
MPN045 53077..54321 hisS g1673766 B01_orf414o conf, histidyl-tRNA synthetase   1HTT-A   MG035   lc: 232..247; homodimer; translation MP109 complement(151480..152724)
MPN046 54293..55966 aspS g1673765 D09_orf557 conf, aspartyl-tRNA synthetase   1ASY-A   MG036 MPN277, MPN252, MPN214     MP108 complement(149835..151508)
MPN047 55942..57297 D09_orf451 g1673764 D09_orf451 new_conf, similar to nicotinate phosphoribosyl transferase     cofactor metabolism; nicotinate + 5-PRPP = nicotinate-ribonucleotide + PPi MG037     new_conf; however, just sequence similarity; similar to NICOTINATE PHOSPHORIBOSYLTRANSFERASE;would also explain how NAD is created in MP, as there is only nicotinate imported; seems more likely than the horizontal transfer story of a pre-B-cell factor; psi blast search from the putative human factor converges and finds only homologues from SY and MP,MG; the paper reports only ill chracterized factor; on the other hand psi-blast search with MP107 brings within 2 iterations whole family up and several times relation to nicotinate phosphoribosyl transferases; described also in updated COG1488 MP107 complement(148504..149859)
MPN048 57886..59442 D09_orf518 g1673763 D09_orf518 new, membrane export protein family see: MP334         MPN049, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 cc: 201..251; putative, see MP334 MP106 complement(146359..147915)
MPN049 59619..61517 D09_orf632 g1673761 D09_orf632 new, membrane export protein family see: MP334       MG096 MPN048, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234 sp: 1..28; cc: 317..372; putative, see MP334 MP105 complement(144284..146182)
MPN050 complement(61977..63503) glpK g1673760 D09_orf508 conf, glycerol kinase   1BU6-O Central intermediary metabolism, Other; glycerol kinase (glpK); glycerol + ATP = ADP + glycerol 3-phosphate; MG038     exp: 2D-Gel data from ZMBH Ges. MP104 142298..143824
MPN051 complement(63494..64648) glpD g1673759 D09_orf384 less, glycerol-3-phospate dehydrogenase   1AA8-A Energy metabolism, Aerobic; aerobic glycerol-3-phospate dehydrogenase (GLPD); Sn-glycerol 3-phosphate+ NAD = glycerone phosphate + NADH ; MG039     less:glycerol-3-phospate dehydrogenase exp: 2D-Gel data from ZMBH Ges. MP103 141153..142307
MPN052 64831..66804 D09_orf657 g1673758 D09_orf657 conf, putative lipoprotein, MG040 homolog, from M. genitalium       MG040   sp: 1..20; lc: 258..270; exp: 2D-Gel data from ZMBH, TX-UF, Ges.; Gel96+258 ca. 8kD c-term. Stueck, Gel140+157 22kD Bruchst. aus Mitte, IEP ca. 9.8 MP102 complement(138997..140970)
MPN053 66822..67088 ptsH g1673757 D09_orf88 conf, phosphocarrier protein HPr   1PCH transporter, general PTS system component; MG041     N-term-seq MKKIGVVKD as predictes; expressed as protein; 2D-Gel data from ZMBH, Ges., Cytosol; MP101 complement(138713..138979)
MPN054 68627..68998 D09_orf123 g1673756 D09_orf123 conserved hypothetical see: MP199         MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..22; less MP100 complement(136803..137174)
MPN055 70404..72086 potA g1673754 D09_orf560L conf, spermidine/putrescine transport ATP-binding prot     Transporter, ABC superfamily; polyamine transport MG042 MPN134, MPN081, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 cc: 148..223;   MP099 complement(133715..135397)
MPN056 72088..72948 potB g1673753 D09_orf286b conf, spermidine/putrescine transport system permease     Transporter, ABC superfamily; polyamine transport MG043 MPN057 sp: 1..32; tm: 64..84 93..113 138..158 193..213 248..268; lc: 114..126;   MP098 complement(132853..133713)
MPN057 72941..73801 potI g1673752 D09_orf286a conf, spermidine/putrescine transport system permease     Transporter, ABC superfamily; polyamine transport MG044 MPN056, MPN637, MPN610 sp: 1..40; tm: 78..98 121..141 144..164 195..215 246..266;   MP097 complement(132000..132860)
MPN058 73786..75243 D09_orf485 g1673751 D09_orf485 conserved hypothetical       MG045   sp: 1..23; lc: 391..415 423..439; less, unknown function; suggestion STRING-server: periplasmic binding, ABC transporter; MP096 complement(130558..132015)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN059 75243..76202 gcp g1673750 D09_orf319 conf, o-sialoglycoprotein endopeptidase       MG046       MP095 complement(129599..130558)
MPN060 76186..77337 metX g1673749 D09_orf383 conf, S-adenosylmethionine synthetase 2   1FUG-A   MG047       MP094 complement(128464..129615)
MPN061 complement(77625..78977) ffh g1673748 D09_orf450 conf, signal recognition particle protein   1FFH   MG048 MPN425     MP093 126824..128176
MPN062 79033..79749 deoD g1673747 D09_orf238 conf, purine-nucleoside phosphorylase   1A69-A Purines, pyrimidines, nucleosides and nucleotides, Salvage of nucleosides and nucleotides; purine-nucleoside phosphorylase; Purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate; in addition it can transfer ribose from one base to another base; note that MP089 - MP092 all could work together, operon like; MG049     exp: N-term-seq MTPHINAKKD as predicted; expressed as a protein; MP092 complement(126052..126768)
MPN063 79753..80427 deoC g1673746 D09_orf224 conf, deoxyribose-phosphate aldolase     Energy metabolism, Sugars. deoxyribose-phosphate aldolase (deoC); 2-deoxy-D-ribose 5-phosphate = D-glyceraldehyde 3-phosphate + acetaldehyde; MG050     exp: 2D-Gel data from ZMBH, Ges., IEP 8.9; MP091 complement(125374..126048)
MPN064 80414..81679 deoA g1673745 D09_orf421 conf, thymidine phosphorylase   1TPT Purines, pyrimidines, nucleosides and nucleotides, purine ribonucleotide biosynthesis; thymidine phosphorylase; Thymidine + Phosphate = Thymin + deoxyribose 1-phosphate. MG051       MP090 complement(124122..125387)
MPN065 81690..82091 cdd g1673744 D09_orf133 conf, cytidine deaminase   1AF2-A Purines, pyrimidines, nucleosides and nucleotides, purine ribonucleotide biosynthesis;cytidine deaminase; Cytidine + H2O = uracile + NH3. MG052     exp: 2D-Gel data from ZMBH, Ges. MP089 complement(123710..124111)
MPN066 82081..83745 cpsG g1673743 D09_orf554 less, two functions are possible, as both enzymes are homologous to each other: phosphomannomutase or phosphoglucomutase   1JDY-A Energy metabolism, Sugars; phosphomannomutase (cpsG); D-mannose 1-phosphate = D-mannose 6-phosphate; phosphoglucomutase; D-glucose 1-phosphate = D-glucose 6-phosphate; MG053     less; second enzyme is homolgous; looking at the pathway, the isolated mannose activity makes not too much sense; the phosphoglucomutase seems to fit better; MP088 complement(122056..123720)
MPN067 complement(83713..84675) nusG g1673742 D09_orf320 conf, transcription antitermination factor       MG054     exp: expressed as protein; N-term-seq MEQVELIPQT as predicted; MP087 121126..122088
MPN068 complement(84683..85060) D09_orf125 g1673741 D09_orf125 new_conf, SecE       MG055   tm: 91..111; new_conf Koonin COG; SecE Protein Transport system; -----qvcebrhujgpolinx [N] COG0690 Preprotein translocase subunit SecE MP086 120741..121118
MPN069 complement(85066..85212)   New identified New identified ribosomal protein L33               085-086 120589..120735
MPN070 complement(85228..85611) D09_orf127a g1673739 D09_orf127a conf, D09_orf127a Protein       MG055.2   sp: 1..27; tm: 56..76;   MP085 120190..120573
MPN071 complement(85598..86428) yabC g1673738 D09_orf276 hypothetical protein (yabC) homolog; similar to Swiss-Prot Accession Number P37544, from B. subtilis       MG056     exp: RNA data from ZMBH, only at 32 degrees (twice), RNA-expressed; MP084 119373..120203
MPN072 complement(86410..86946) yabF g1673737 D09_orf178 new_conf, similar to nucelotidyl transferase/polynicleotide cleavage       MG057   1-100 Toprim domain; exp: RNA data from ZMBH, RNA-expressed; sequence annotation or this protein by Aravind in pubmed PMID: 9722641, UI: 98391745; new_conf koonin; MP083 118855..119391
MPN073 complement(86925..88091) prs g1673736 D09_orf388 conf, phosphoribosylpyrophosphate synthetase   1OPR Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis; phosphoribosylpyrophosphate synthetase (prs); ATP + Ribose5Phosphate = PhosphoRibosylPyrroPhosphate + AMP. MG058 MPN033, MPN395   Mikita noticed here an overlap of 194 nts with MP081; new_conf Bairoch swissprot P75044 considers that this protein starts in fact really at MGLITHNEFA, so later MP082 117710..118876
MPN074 complement(87898..88341) D09_orf147 g1673735 D09_orf147 hypothetical protein (A43259) homolog; similar to GenBank Accession Number A43259, from E. hirae       MG059     exp: RNA data from ZMBH, RNA-expressed; MP081 117460..117903
MPN075 88348..89247 ywdF g1673734 D09_orf299 new_conf, Glycosyl Transferase       MG060 MPN028   new_conf pfam; Pfam:Glycos_transf_2 (4-170); exp: RNA data from ZMBH, RNA-expressed; MP080 complement(116554..117453)
MPN076 complement(89299..90993) uhpT g1673733 R02_orf564o HYPOTHETICAL PROTEIN       MG061 MPN077 sp: 1..25; tm: 87..107 168..188 221..241 249..269 306..326 361..381 391..411 415..435 455..475 503..523; less; HYPOTHETICAL PROTEIN; exp: RNA data from ZMBH, RNA-expressed; MP079 114808..116502
MPN077 complement(91199..92839) R02_orf469 g1673732 R02_orf469 hypothetical, see: MP079         MPN076 sp: 1..28; tm: 110..130 143..163 171..191 224..244 267..287 300..320 323..343 362..382 403..423; lc: 55..72;   MP078 113193..114602
Ser-tRNA(AGC) complement(93052..93140) mptgsb                     complement(93052..93140) 112661..112749
MPN078 93191..95275 fruA g1673731 R02_orf694 conf, fructose-permease IIBC component   1A6J-A transporter, PTS; for fructose; note just besides 1-phosphofructokinase MP076, MP077 generates fuctose 1-phosphate during transport; MG062 MPN651, MPN575 tm: 318..338 365..385 422..442 461..481 500..520 544..564 577..597 605..625 656..676;   MP077 complement(110526..112610)
MPN079 95268..96170 fruK g1673730 R02_orf300 conf, 1-phosphofructokinase   1RKD Energy metabolism, Glycolysis; 1-phosphofructokinase (fruK); fructose 1-phosphate + ATP = fructose 1,6-biphosphate; note that this immediately turns the fructose 1-phosphate generated by transport from MP067 into glycolysis; MG063   lc: 162..171; exp: 2D-Gel data from ZMBH, Ges., ca. 36kD; MP076 complement(109631..110533)
MPN080 96407..100567 R02_orf1386V g1673728 R02_orf1386V new, Probably ABC transporter membrane protein subunit     Transporter, ABC superfamily; probably membrane subunit for MP074; MG064 MPN684 sp: 1..31; tm: 517..537 561..581 606..626 682..702 1259..1279 1301..1321 1349..1369; lc: 286..303; blast finds at 0.0037 part of the ABC transporter membrane protein and we have the TM regions (see intrinsics), furthermore MP074 requires its other component one could tentatively suggest this. Q 505-597; S359-450; Streptococcus mutans ABC transporter; (higher 4 blast values only for hypothetical proteins); no COG,Koonin; no Sternberg (1.3.00); MP075 complement(105234..109394)
MPN081 100567..101964 glnQ g1673727 R02_orf465 conf, glutamine transport ATP-binding protein     Transporter, ABC superfamily; transports glutamine, perhaps more aminoacids; MG065 MPN134, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193     MP074 complement(103837..105234)
MPN082 101985..103931 tklB g1673726 R02_orf648 conf, transketolase 1   1AY0-A Energy metabolism, Pentose Phosphate pathway; transketolase 1; Sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-ribose 5-phosphate + D-xylulose 5-phosphate note: Thiamin pyrophosphate cofactor Wide specificity for both reactants, e.g. converts hydroxypyruvate and R-CHO into CO(2) and R-CHOH-CO-CH(2)OH.Transketolase e.g.from Alcaligenes faecalis shows high activity with D-erythrose as acceptor. This enzyme could fill up several gaps in PPP. MG066 MPN393 lc: 545..559; exp: 2D-Gel data from ZMBH, Ges., MP073 complement(101870..103816)
MPN083 103941..105542 R02_orf533 g1673725 R02_orf533 only a conserved hypothetical,MG067 homolog, from M. genitalium       MG067 MPN084, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 sp: 1..24; less; HYPOTHETICAL PROTEIN, MP072 complement(100259..101860)
MPN084 105592..107166 R02_orf524 g1673724 R02_orf524 conserved hypothetical, see: MP072       MG068 MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 sp: 1..22;   MP071 complement(98635..100209)
MPN085 107273..108595 R02_orf440 g1673723 R02_orf440 new, adhesin P1 (group2) homolog; see: MP025         MPN129, MPN090, MPN087, MPN086, MPN593 sp: 1..45; tm: 56..76 95..115 138..158 209..229 245..265 268..288 392..412; cc: 116..137; via homology to MP025 MP070 complement(97206..98528)
MPN086 108857..109174 R02_orf105 g1673722 R02_orf105 new, adhesin P1 (group2) homolog; see: MP025         MPN085, MPN435 sp: 1..45; tm: 64..84; via homology to MP070 MP069 complement(96627..96944)
MPN087 109346..109798 R02_orf150 g1673721 R02_orf150 new, adhesin P1 (group2) homolog; see: MP025         MPN085 tm: 43..63 85..105 124..144; via homology to MP070 MP068 complement(96003..96455)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN088 110813..111118 R02_orf101 g1673718 R02_orf101 conf, R02_orf101 Protein               MP067 complement(94683..94988)
MPN089 111610..112617 hsdS g1673717 R02_orf335 conf, see: MP335         MPN638, MPN615, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201 lc: 105..126; family, see main representative MP335 MP066 complement(93184..94191)
MPN090 112772..113761 R02_orf329 g1673716 R02_orf329 new, adhesin P1 (group2) homolog; see: MP025         MPN129, MPN085 sp: 1..43; tm: 78..98 163..183 218..238 265..285 299..319; lc: 193..209; via homology to MP025 MP065 complement(92040..93029)
MPN091 113838..114254 R02_orf138 g1673715 A05_orf139 conserved hypothetical,see: MP378         MPN115, MPN463     MP064 complement(91547..91963)
MPN092 114572..115093 R02_orf173 g1673714 R02_orf173 new_conf, involved in cytadherence,see: MP012         MPN149, MPN142, MPN102, MPN503, MPN464, MPN414, MPN367   exp: RNA data from ZMBH, RNA-expressed; MP062 complement(90708..91229)
MPN093 114948..115853 R02_orf301 g1673713 R02_orf301 new_conf, involved in cytadherence, see: MP012         MPN150, MPN142, MPN102, MPN503, MPN464, MPN414, MPN367 lc: 49..62; exp: RNA data from ZMBH, RNA-expressed; MP061 complement(89948..90853)
MPN094 116287..116709 R02_orf140 g1673712 R02_orf140 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 116..139; URF; exp: RNA data from ZMBH, RNA-expressed; MP060 complement(89092..89514)
16S_rRNA 118312..119824 No info     The region is selected according to Database of Small Subunit of rRNA and Genbank(acc:M29061). In the ssu DB, 3'-48 more residues to M29061 are expected by alignment of closely related species, so I extended the 48 residue to the region that is coverd by M29061. M29061 lacks 5'-TCA and 3'-56 residues comparing to ZMBH www page. There are 5 mismatchs between the selected region in the genome sequence and M29061 (4 out of 5 is 'N' in M29061).               118312..119824 complement(85977..87489)
23S_rRNA 120057..122961 No info     The region is selected according to Database of Large Subunit of rRNA and Genbank(acc:X68422). X68422 lacks 5'-A but more 3'-179 residues comparing to ZMBH www page.               120057..122961 complement(82840..85744)
5S_rRNA 122999..123106 No info     no 5S rRNA in Genbank. The region is selected according to the 5S rRNA DB (rose.man.poznan.pl/5SData). In ZMBH www page, 5'-TTTGG is missing.               122999..123106 complement(82695..82802)
MPN095 123290..124054 R02_orf254 g1673710 R02_orf254 new_conf, aa_permeases see: MP058     Transporters, probably APC family like; amino acid permease   MPN308 sp: 1..33; tm: 53..73 105..125 145..165 179..199 213..233; new_conf; Homology with Nterm of MP528 (aa_permeases) join MP059 MP058 = MP528 Pfam:aa_permeases (Evalue - 0.64) See aligment. Also confirmed by COG0531 MP059 complement(81747..82511)
MPN096 124054..124848 R02_orf264 g1673709 R02_orf264 new_conf, aa_permeases     Transporters, probably APC family like; amino acid permease   MPN308 sp: 1..20; tm: 40..60 101..121 147..167 179..199 216..236; new_conf; Homology with Cterm of MP528 (aa_permeases) join MP059 MP058 = MP528 Pfam:aa_permeases (Evalue - 0.64) See aligment. Also confirmed by COG0531 MP058 complement(80953..81747)
MPN097 125024..126649 R02_orf541 g1673708 R02_orf541 conserved hypothetical see: MP631         MPN152, MPN147, MPN146, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 sp: 1..27; lc: 39..52 224..238 406..418 448..460; see comments to MP631. MP057 complement(79152..80777)
MPN098 126947..127390 R02_orf147 g1673707 R02_orf147 conserved hypothetical see: MP631         MPN152, MPN147, MPN506, MPN408, MPN364, MPN288, MPN284, MPN282, MPN200, MPN199   see comments to MP631. MP056 complement(78411..78854)
MPN099 128076..129119 R02_orf347L g1673706 R02_orf347L conf, see: MP013         MPN144, MPN141, MPN132, MPN500, MPN409, MPN370, MPN286, MPN203, MPN202 lc: 189..209 306..327;   MP055 complement(76682..77725)
MPN100 129458..130009 R02_orf183o g1673705 R02_orf183o hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 116..142; exp: RNA data from ZMBH, RNA-expressed; MP054 complement(75792..76343)
MPN101 130466..131752 C09_orf428V g1673703 C09_orf428V conf, see: MP013         MPN141, MPN128, MPN502, MPN462, MPN370, MPN205 lc: 131..140 170..190 249..268 366..378;   MP053 complement(74049..75335)
MPN102 132568..133386 C09_orf272 g1673702 C09_orf272 new_conf, involved in cytadherence, see: MP012         MPN150, MPN149, MPN142, MPN093, MPN092, MPN503, MPN464, MPN414, MPN367 lc: 13..28; exp: RNA data from ZMBH, at 32 degrees, only once; RNA-expressed ? MP052 complement(72415..73233)
MPN103 complement(134055..134573) C09_orf172 g1673701 C09_orf172 conf, C09_orf172 Protein         MPN037, MPN465 tm: 26..46;   MP051 71228..71746
MPN104 134583..134897 C09_orf104 g1673700 C09_orf104 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF; exp: RNA data from ZMBH, high at 32 and 37, RNA-expressed; MP050 complement(70904..71218)
MPN105 135731..136756 pheS g1673699 C09_orf341 conf, phenylalanyl-tRNA synthetase alpha-subunit   1PYS-A, 1PYS-B, 1ASY-A   MG194       MP049 complement(69045..70070)
MPN106 136759..139176 pheT g1673698 C09_orf805 conf, phenylalanyl-tRNA synthetase beta chain   1PYS-B   MG195 MPN663     MP048 complement(66625..69042)
MPN107 139289..140044 C09_orf251 g1673697 C09_orf251 conserved hypothetical protein           lc: 186..196; Lactococcus lactis Region new_add; similarity Lactococcus lactis(sptrembl:O53069) Funtional annotation of Lactococcus lactis proteins is probably wrong; exp: RNA data from ZMBH, 32 degrees (twice), RNA-expressed; MP047 complement(65757..66512)
MPN108 140046..141260 C09_orf404 g1673696 C09_orf404 conserved hypothetical, see: MP043         MPN111 lc: 262..276; Lactococcus lactis Region new_add; similarity C-ter (843-1268) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. MP046 complement(64541..65755)
MPN109 141940..142437 C09_orf165 g1673694 C09_orf165 conf, C09_orf165 Protein           cc: 71..98; 2d-Gel-PH Ges. MP045 complement(63364..63861)
MPN110 142361..144517 C09_orf718 g1673693 C09_orf718 conserved hypothetical protein           lc: 581..598; Lactococcus lactis Region new_add; similarity N-ter (293-701) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. exp: RNA data from ZMBH, both at 32 and 37 degrees; RNA-expressed MP044 complement(61284..63440)
MPN111 145021..146289 C09_orf422 g1673692 C09_orf422 conserved hypothetical protein         MPN108   Lactococcus lactis Region new_add; similarity C-ter (843-1268) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. exp: RNA data from ZMBH, but only once at 32 degree seen with low expression (below 150 not sure above background): Really doubtful / URF MP043 complement(59512..60780)
MPN112 147149..147541 C09_orf130b g1673691 C09_orf130b new_conf, permease         MPN421 tm: 32..52 71..91 101..121; via homology to MP420; also COG0477; MP042 complement(58260..58652)
MPN113 148090..148761 C09_orf223 g1673690 C09_orf223 new, Similarity to G3P transporters         MPN421 tm: 28..48 60..80 91..111 174..194; new; Join MP42 MP41 Similarity with G3P transporters MP041 complement(57040..57711)
MPN114 148751..150553 cpt2 g1673689 C09_orf600 more__, Acyltransferase     Fatty acid and phospholipid metabolism; carnitine acyltransferase; acylCoA + carnitin = CoA + acylcarnitine; transporter, membrane carrier;     lc: 129..141; new_add; Horizontal Transfer less; Acyltransferase Probably Carnitine dependent MP040 complement(55248..57050)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN115 150643..151248 infC g1673688 C09_orf201 conf, translation initiation factor IF3   2IFE, 1TIF   MG196       MP039 complement(54553..55158)
MPN116 151254..151433 rpmI g1673687 C09_orf59 conf, ribosomal protein L35       MG197     SUB; SUB ribosomal; annot full length true (psi-blast); MP038 complement(54368..54547)
MPN117 151444..151827 rpLT g1673686 C09_orf127 conf, ribosomal protein L20       MG198     SUB; MP037 complement(53974..54357)
MPN118 complement(151802..152512) C09_orf143b g1673685 C09_orf143b new_conf, Similarity with Ribonuclease HII       MG199   lc: 71..84; new_conf; Dr.M.Itaya Similarity with Ribonuclease HII; to be more exact, with rnhC from B.subtilis (J.Bacteriol 181, 2118-2123; in psi-blast one finds only that it is an RNAseH II / rnhB, but the direct investigation in B.sub indicates more rnhC as far as B.sub co9ncerned; essential gene; Mikitas extension gives a much more sensible weight of 23.6 kDa; B.sub has 33.9; RNA data from ZMBH, exp: the gene is well expressed. Question: Is there confirmatory size estimate by Northern available (or even by two different oligos to show that N-terminal extension IS expressed) ? (N-terminal sequencing is even better); Bairoch: protein starts at the old start P75446 swissnew MP036 53568..53999
MPN119 152568..155300 C09_orf910 g1673683 C09_orf910 less, contains j-domain of DnaJ; and a domain common to cytadherence proteins 1-77 similar to j-domain of DnaJ; 233-259 domain present only in MP/MG 1HDJ cochaperon (?) possible activation of DnaK MG200 MPN021, MPN002, MPN567, MPN447, MPN391 lc: 109..120 268..284; unconnected; contains a domain repeated in DNJM/P200/HMV1 of both MP/MG (cytadherence related proteins); story: possible link between cell surface and chaperon activity; not a DnaJ but likely to activate DnaK as it contains a j-domain of DnaJ; exp: 94149015 _ECOLI MP035 complement(50501..53233)
MPN120 155323..155976 grpE g1673682 C09_orf217 conf, heat shock protein GrpE   1DKG-A chaperon MG201   cc: 23..104; sub:hsp70 with DnaJ, MP133 and DnaK MP407 2D-Gel data from ZMBH, Ges., IEP 8.2 MP034 complement(49825..50478)
MPN121 155976..156341 C09_orf121 g1673681 C09_orf121 conserved hypothetical       MG202     Only hits MG; MP033 complement(49460..49825)
Thr-tRNA(ACC) complement(156359..156432) mptgt     in Genbank, [tRNA] /note="codon recognized: GGT" and [gene] /note="Thr-tRNA(GGU) gene" are wrong.               complement(156359..156432) 49369..49442
MPN122 156467..158374 parB g1673680 C09_orf635 conf, topoisomerase IV subunit B   1BGW, 1AJ6   MG203 MPN003 lc: 458..471; sub; B TOPOISOMERASE IV MP032 complement(47427..49334)
MPN123 158374..160743 parC g1673679 C09_orf789 conf, topoisomerase IV subunit A   1AB4   MG204 MPN004 cc: 432..463; lc: 289..303; sub; A TOPOISOMERASE IV MP031 complement(45058..47427)
MPN124 complement(160730..161785) yqxE g1673678 C09_orf351 conf, protein (hrcA) homolog; similar to Swiss-Prot Accession Number P25499, from B. subtilis     cell control MG205   cc: 317..343; represses expression of Dnak and GroE operons MP030 44016..45071
MPN125 161817..163577 uvrC g1673677 C09_orf586L conf, excinuclease ABC subunit C       MG206   lc: 317..330; sub; Subunit C EXCINUCLEASE ABC MP029 complement(42224..43984)
MPN126 163613..164092 C09_orf159 g1673676 C09_orf159 conf, MG207 homolog, from M. genitalium       MG207     2D-Gel data from ZMBH MP028 complement(41709..42188)
MPN127 164484..165026 C09_orf180 g1673675 C09_orf180 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF but exp: RNA data from ZMBH, RNA-expressed; MP027 complement(40775..41317)
MPN128 166483..166932 C09_orf149a g1673674 C09_orf149a conf, see: MP013         MPN141, MPN101, MPN502, MPN462, MPN205 lc: 26..45;   MP026 complement(38869..39318)
MPN129 167632..168081 C09_orf149b g1673673 C09_orf149b conf, adhesin P1 (group 2) homolog; similar to GenBank Accession Number A41480, from M. pneumoniae         MPN090, MPN085 tm: 41..61 88..108 113..133;   MP025 complement(37720..38169)
MPN130 169042..169464 C09_orf140o g1673672 C09_orf140o hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 97..139; URF but exp: RNA data from ZMBH, RNA-expressed; MP024 complement(36337..36759)
MPN131 170068..170733 E07_orf221V g1673670 E07_orf221V conf, see: MP013         MPN144, MPN141, MPN500, MPN468, MPN409, MPN370, MPN286, MPN202 lc: 20..36 111..126 184..199;   MP023 complement(35068..35733)
MPN132 171049..171819 E07_orf256L g1673669 E07_orf256L conf, see: MP013         MPN144, MPN141, MPN099, MPN500, MPN409, MPN370, MPN286, MPN203, MPN202 lc: 53..75 126..137 155..167 170..186;   MP022 complement(33982..34752)
MPN133 172277..173182 E07_orf301 g1673668 E07_orf301 conf, putative lipoprotein, MG186 homolog, from M. genitalium       MG186   sp: 1..26; cc: 62..94; lc: 227..240;   MP021 complement(32619..33524)
MPN134 173206..174966 ugpC g1673667 E07_orf586 conf, sn-glycerol-3-phosphate transport system permease protein     Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit; MG187 MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 cc: 229..254 320..346; add: 123-336 insertion of charge residues, 2D-Gel data from ZMBH Ges. MP020 complement(30835..32595)
MPN135 174959..175948 ugpA g1673666 E07_orf329 conf, sn-glycerol-3-phosphate transport system permease protein     Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit; MG188 MPN136 tm: 32..52 97..117 127..147 232..252 283..303;   MP019 complement(29853..30842)
MPN136 175920..176879 ugpE g1673665 E07_orf319 conf, sn-glycerol-3-phosphate transport system permease protein     Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit; MG189 MPN135 tm: 41..61 103..123 134..154 169..189 230..250 283..303;   MP018 complement(28922..29881)
MPN137 complement(177457..178143) E07_orf228 g1673664 E07_orf228 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 113..222; URF but exp: RNA data from ZMBH, RNA-expressed; MP017 27658..28344
MPN138 complement(178392..178892) E07_orf166 g1673663 E07_orf166 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 69..149; URF but exp: RNA data from ZMBH, RNA-expressed; MP016 26909..27409
MPN139 complement(179129..179620) E07_orf163 g1673662 E07_orf163 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 76..103; URF but exp: RNA data from ZMBH, RNA-expressed; MP015 26181..26672
MPN140 179871..180845 orf4 g1673660 E07_orf324 new_conf, DHH family phosphoesterases       MG190 MPN549   new_conf;(17-320)Pfam:PF01368 DHH family Evalue 1e-05 exp;Trends Biochem Sci 23: 17-19 (1998)[PMID9478130,MUID98138617] A novel family of predicted phosphoesterases includes Drosophila prune protein and bacterial RecJ exonuclease. L. Aravind & E. V. Koonin; exp: RNA data from ZMBH, RNA-expressed; The phosphoesterase should functinally aid the attachment -> could have pharmacological implications. P1 cytadherence operon; MP014 complement(24956..25930)
MPN141 180858..185741 P1 g1673659 E07_orf1627 conf, ADP1_MYCPN adhesin P1       MG191 MPN144, MPN142, MPN132, MPN131, MPN128, MPN101, MPN099, MPN502, MPN500, MPN468, MPN462, MPN453, MPN409, MPN370, MPN286, MPN205, MPN203, MPN202 sp: 1..27; tm: 530..550 1105..1125 1527..1547; lc: 261..280 337..350 832..849 963..975 1225..1237 1298..1326; 2D-Gel data from ZMBH, Ges., ca. 80 kD, IEP ca. 7.3 former expression study; P1 cytadherence operon; MP013 complement(20060..24943)
MPN142 185747..189403 orf6 g1673658 E07_orf1218 new_conf, involved in cytadherence       MG192 MPN150, MPN149, MPN141, MPN102, MPN093, MPN092, MPN503, MPN464, MPN414, MPN367, MPN366 sp: 1..23; tm: 1123..1143; lc: 116..132 297..324 538..551; exp: RNA data from ZMBH, former expression result, 2D-Gel data from ZMBH, N-term 40kD Fragment, IEP ca. 10.1, RNA-expressed; orf6 of P1 cytadherence operon, the 130kD precursor, this splits into 40kD(B) and 90kDa(C), cytadherence associated, exact molecular function unknown; Note that MP012-MP014 probably form an operon as suggested (not more) by RBS and termination site for polycistronic messenger (Gene 82, 259-267; Inamine et al.,1989; UI: 90060815 ) ; however a point mutation in the P1 gene is accompanied by the loss of B and C (Krause,D. Mol Microbiol 20,247-253; 1996). With the experimental data and the literature this protein is no longer hypothetical. MP012 complement(16398..20054)
MPN143 189520..190047 E07_orf175 g1673657 E07_orf175 hypothetical             Hits nothing, URF?; MP011 complement(15754..16281)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN144 190621..191862 E07_orf413 g1673656 E07_orf413 conf, see: MP013         MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN286, MPN203, MPN202 lc: 43..55 264..284 303..318 375..401;   MP010 complement(13939..15180)
MPN145 192214..192753 E07_orf179 g1673655 E07_orf179 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 152..178; lc: 58..71; URF, but exp: RNA data from ZMBH, RNA-expressed; MP009 complement(13048..13587)
MPN146 193071..193868 E07_orf265 g1673654 E07_orf265 conserved hypothetical, see: MP631         MPN152, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN281, MPN200, MPN199   see comments to MP631. MP008 complement(11933..12730)
MPN147 193875..195332 E07_orf485 g1673653 E07_orf485 conserved hypothetical, see: MP631         MPN152, MPN098, MPN097, MPN506, MPN408, MPN364, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 lc: 155..174; see comments to MP631. MP007 complement(10469..11926)
MPN148 195875..196297 E07_orf140 g1673652 E07_orf140 conserved hypothetical, see: MP199         MPN012, MPN011, MPN649, MPN505, MPN466, MPN411, MPN369, MPN271     MP006 complement(9504..9926)
MPN149 196850..198154 E07_orf434 g1673650 E07_orf434 new_conf, see: MP012         MPN142, MPN102, MPN092, MPN503, MPN464, MPN414, MPN367, MPN366 lc: 70..86; but exp: RNA data from ZMBH, RNA-expressed; MP005 complement(7647..8951)
MPN150 197982..198656 E07_orf224 g1673649 E07_orf224 new_conf, see: MP012         MPN142, MPN102, MPN093, MPN503, MPN464, MPN414, MPN367   but exp: RNA data from ZMBH, RNA-expressed; MP004 complement(7145..7819)
MPN151 199139..199540 E07_orf133 g1673648 E07_orf133 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF; but exp: RNA data from ZMBH, RNA-expressed; MP003 complement(6261..6662)
MPN152 199823..202207 E07_orf794 g1673647 E07_orf794 conserved hypothetical, see: MP631         MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 sp: 1..27; lc: 39..52 229..244 472..501; less, see comments to MP631. 2D-Gel data from ZMBH, 17kD, Ges., IEP ca. 10 ? MP002 complement(3594..5978)
MPN153 202383..205724 E07_orf1113 g1673646 E07_orf1113 conserved hypothetical, MG140 homolog, from M. genitalium       MG140   lc: 958..970 1003..1016;   MP001 complement(77..3418)
Leu-tRNA(TTG) 205801..648993                       205801..648993 complement(373202-373283)
MPN154 205801..207423 nusA g1674384 E07_orf540o conf, N-utilization substance protein A homolog; similar to Swiss-Prot Accession Number P32727, from B. subtilis       MG141 MPN452, MPN447, MPN167 lc: 67..83 453..504; Significant similarity to nusA from other bacterias. Other nusA is -500 aa and similar region between MP677 and others is from N-terminal to 370 aa. Rest of the segment have no similarity, except for MG. MP677 complement(814772..816394)
MPN155 207704..209557 infB g1674382 VXpSPT7_orf617 conf, protein synthesis initiation factor 2   1EFU   MG142 MPN665, MPN475, MPN279, MPN227 cc: 386..418; sub translation initiation afctor; Only MP and MG have much shorter sequences. Others have 100-300 more residues at their N-terminal. One of the three factors required for the initiation of protein biosynthesis in bacteria. Other factors are: IF-1 (infA) (MP644) and IF-3 (infC) (MP039). MP676 complement(812638..814491)
MPN156 209560..209910 rbfA g1674381 VXpSPT7_orf116 conf, ribosome binding factor A       MG143     SUB; MP675 complement(812285..812635)
MPN157 209926..211134 VXpSPT7_orf402 g1674380 VXpSPT7_orf402 conserved hypothetical       MG144 MPN452 tm: 279..299 328..348 359..379; lc: 49..72 114..151 161..184; No homologs other than MG144, which has 279 aa and match C-terminal part of MP674. N-termianl 120 aa of MP674 has no homology. exp: RNA data from ZMBH, RNA-expressed; MP674 complement(811061..812269)
MPN158 211147..211956 yaaC g1674379 VXpSPT7_orf269 conf, riboflavin kinase (EC 2.7.1.26) (flavokinase) / FMN adenylyltransferase (EC 2.7.7.2) (FAD pyrophosphorylase) (FAD synthetase); bifunctional     (EC 2.7.1.26) ATP + riboflavin = ADP + FMN; (EC 2.7.7.2) ATP + FMN = diphosphate + FAD. hypothesis: Can do in fact also ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD(+) EC 2.7.7.18 MG145     conf, because the description in P22990 means exactly that;SwissProt (P75587, RIBF_MYCPN) and Koonin's annotation to MG145 already assigned this double function, too. exp: _CORAM UI: 98322073; Though this is a bifunctional enzyme, the two reactions occur at a single active site. Bold hypothesis (has to be checked by experiment): reaction EC 2.7.7.18 for NAD synthesis pathway (see MP107, MP280) is also possible by this enzyme. exp: RNA data from ZMBH, RNA-expressed; MP673 complement(810239..811048)
MPN159 211982..213256 hlyC g1674378 VXpSPT7_orf424 wrong_, tlyC homolog, hemolysin activity doubtful, see comments       MG146   sp: 1..29; tm: 67..87 100..120 134..154; wrong: not hlyC homolog but tlyC homolog; 1-29, signal peptide; 67-87, TM; 100-120, TM; 134-154, TM; 215-264, CBS (e=3.6e-4); 278-326, CBS (e=0.11); This entry has significant similarity to 'hypothetical' and 'hemolysin homolog' proteins. But no similarity to hemolysins (hlyC) from gram-negative bacterias. exp: _TREHY UI: 95058097; So far, only one paper about hemolytic activity of tlyC from Serpulina hyodysenteriae: MICROB. PATHOG. 16:269-82 (1994). This sequence is shorter (268 aa) than MP, and corresponds to 150-350 of MP. MP672 complement(808939..810213)
MPN160 213243..214376 VXpSPT7_orf377 g1674377 VXpSPT7_orf377 conserved hypothetical       MG147   sp: 1..37; tm: 66..86 160..180 205..225 293..313 335..355; No homologs other than MG147. 1-37, signal peptide; 66-86, TM; 160-180, TM; 205-225, TM; 293-313, TM; 335-355, TM exp: RNA data from ZMBH, RNA-expressed; MP671 complement(807819..808952)
MPN161 214530..215867 VXpSPT7_orf445 g1674376 VXpSPT7_orf445 conserved hypothetical       MG148   cc: 85..192 411..437; lc: 47..61; No homologs other than MG148. 85-192, CC; 411-438, CC. exp: RNA data from ZMBH, 32 degrees once, but clear, RNA-expressed; exp-PH: XDVKYLQVE N-term as predicted; could be expressed in Hep C8; MP670 complement(806328..807665)
MPN162 215989..216951 VXpSPT7_orf320 g1674375 VXpSPT7_orf320 conserved hypothetical       MG149   sp: 1..25; lc: 62..82 86..98 171..186 206..258; No homologs other than MG149. 1-25, signal peptide. Characteristics of lipoproteins, i.e., (i) one or more basic residues near N-terminal, (ii) signal peptide, and (iii) a Cys residue downstream of the signal peptide, can be seen both of the MP and MG sequences. MP669 complement(805244..806206)
MPN163 217198..217536 VXpSPT7_orf112 g1674374 VXpSPT7_orf112 conserved hypothetical       MG149.1   sp: 1..33; tm: 38..58; lc: 79..91; 1-33, Signal peptide; 38-58, TM. PSI-Blast detects nothing other than MG149.1. MP668 complement(804659..804997)
MPN164 217630..217956 rpsJ g1674372 VXpSPT7_orf108 conf, ribosomal protein S10       MG150   lc: 29..44; SUB; MP667 complement(804239..804565)
MPN165 217970..218833 rplC g1674371 VXpSPT7_orf287 conf, ribosomal protein L3       MG151   lc: 228..252; SUB; MP sequence is much longer than others. MG lacks C-terminal 30 residues, and others lack C-terminal 50-70 residues comparing to MP. MP666 complement(803362..804225)
MPN166 218833..219471 rplD g1674370 VXpSPT7_orf212 conf, ribosomal protein L4       MG152   lc: 156..168; SUB; MP665 complement(802724..803362)
MPN167 219474..220187 rplW g1674369 VXpSPT7_orf237 conf, ribosomal protein L23       MG153; MG219   lc: 152..198; SUB; L23 proteins have about 100 residues. Only MP sequence has much longer C-terminal 130 residues. This segment was subjected to homology search (PSI-Blast), but there is no significant homolog. This segment is rich in K, E, A, V, and T. In the segment, 82.5% of the residues are either one of the five amino acids. MP664 complement(802008..802721)
MPN168 220187..221050 rplB g1674368 VXpSPT7_orf287 conf, ribosomal protein L2       MG154     SUB; MP663 complement(801145..802008)
MPN169 221050..221313 rpS19 g1674367 VXpSPT7_orf87 conf, ribosomal protein S19       MG155     SUB; MP662 complement(800882..801145)
MPN170 221240..221794 VXpSPT7_orf184 g1674366 VXpSPT7_orf184 conf, ribosomal protein L22   1BXE   MG156     SUB; Only MP and MG have much longer N- and C-terminal residues (N-terminal 20-25 residues; C-terminal 30-50 residues). SwissProt assigns 26-Met as the first residue for both MP and MG. Bairoch: This starts at MIAFAK... (so 25 aa shorter at N-term). Mikita sees only 1bp intergenic region and that MP661/662 have 74 nts overlap. MP661 complement(800401..800955)
MPN171 221796..222617 rpsC g1674365 VXpSPT7_orf273 conf, ribosomal protein S3       MG157   lc: 85..96 225..238; SUB; Only MP and MG have much longer C-terminal sequences (40-50 residues). MP660 complement(799578..800399)
MPN172 222617..223036 rplP g1674364 VXpSPT7_orf139 conf, ribosomal protein L16       MG158     SUB; MP659 complement(799159..799578)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN173 223036..223371 rpmC g1674363 GT9_orf111b conf, ribosomal protein L29       MG159   lc: 47..59; SUB; MP658 complement(798824..799159)
MPN174 223371..223628 rpsQ g1674362 GT9_orf85 conf, ribosomal protein S17   1RIP   MG160     SUB; MP657 complement(798567..798824)
MPN175 223632..224000 rplN g1674361 GT9_orf122 conf, ribosomal protein L14   1WHI   MG161     SUB; MP656 complement(798195..798563)
MPN176 224000..224335 rplX g1674360 GT9_orf111a conf, ribosomal protein L24       MG162     SUB; MP655 complement(797860..798195)
MPN177 224338..224880 rplE g1674359 GT9_orf180b conf, ribosomal protein L5       MG163   lc: 166..177; SUB; MP654 complement(797315..797857)
MPN178 224882..225067 rpsN g1674358 GT9_orf61 conf, ribosomal protein S14       MG164     SUB; MP653 complement(797128..797313)
MPN179 225061..225489 rpsH g1674357 GT9_orf142 conf, ribosomal protein S8   1AN7-A   MG165     SUB; Only MP and MG have much longer N-terminal sequences (10 residues). MP652 complement(796706..797134)
MPN180 225496..226050 rplF g1674356 GT9_orf184 conf, ribosomal protein L6       MG166     SUB; MP651 complement(796145..796699)
MPN181 226051..226401 rplR g1674355 GT9_orf116b conf, ribosomal protein L18       MG167   lc: 52..63; SUB; MP650 complement(795794..796144)
MPN182 226405..227064 rpsE g1674354 GT9_orf219 conf, ribosomal protein S5   1PKP   MG168   lc: 157..174; SUB; Only MP and MG have much longer N-terminal sequences (50-60 residues). MP649 complement(795131..795790)
MPN183 227068..227523 rplO g1674353 GT9_orf151 conf, ribosomal protein L15       MG169     SUB; MP648 complement(794672..795127)
MPN184 227523..228956 secY g1674352 GT9_orf477 conf, preprotein translocase subunit SecY 83-433, secY (Pfam)     MG170 MPN080 sp: 1..46; tm: 82..102 129..149 165..185 211..231 234..254 286..306 327..347 387..407 412..432; lc: 67..81; sub protein export; One of the components for protein export. Other components are: secA (MP621) and secE (MP086?). MP647 complement(793239..794672)
MPN185 228950..229597 adk g1674351 GT9_orf215 conf, adenylate kinase   3ADK Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis(EC 2.7.4.3); adenylate kinase ATP + AMP = ADP + ADP; note: works also with other NTP. MG171       MP646 complement(792598..793245)
MPN186 229597..230343 map g1674350 GT9_orf248 conf, methionine amino peptidase   1CHM-A (EC 3.4.11.18) L-methionylpeptide + H2O = L-methionine + peptide MG172       MP645 complement(791852..792598)
MPN187 230343..230579 infA g1674349 GT9_orf78 conf, initiation factor 1   1AH9   MG173     sub translation initiation factor; One of the three factors required for the initiation of protein biosynthesis in bacteria. Other factors are: IF-2 (infB) (MP676) and IF-3 (infC) (MP039). MP644 complement(791616..791852)
MPN188 230590..230703 rpmJ g1674348 GT9_orf37 conf, ribosomal protein L36       MG174     SUB; MP643 complement(791492..791605)
MPN189 230703..231077 rpsM g1674347 GT9_orf124b conf, ribosomal protein S13       MG175     SUB; MP642 complement(791118..791492)
MPN190 231077..231442 rpsK g1674346 GT9_orf121 conf, ribosomal protein S11       MG176     SUB; MP641 complement(790753..791118)
MPN191 231448..232431 rpoA g1674345 GT9_orf327 conf, RNA polymerase alpha core subunit   1COO   MG177     sub RNA polymerase MP640 complement(789764..790747)
MPN192 232434..232808 rplQ g1674344 GT9_orf124a conf, ribosomal protein L17 17-119, Ribosomal_L17 (Pfam)     MG178     SUB; MP639 complement(789387..789761)
MPN193 232792..233616 cysA g1674343 GT9_orf274 less, cobalt transport ATP-binding protein 35-217, ABC_tran (Pfam)   Transporter, ABC superfamily; cobalt transporter subunit; MG179 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN571, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194   less: this sequence is higher similar to cobalt transporter than sulfate transporter; sub ABC transporter MP638 complement(788579..789403)
MPN194 233604..234515 hisP g1674342 GT9_orf303 less, cobalt transport ATP-binding protein 47-236, ABC_tran (Pfam)   Transporter, ABC superfamily; cobalt transporter subunit; MG180 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN193   less: this sequence is higher similar to cobalt transporter than histidine transporter; sub ABC transporter MP637 complement(787680..788591)
MPN195 234508..235812 GT9_orf434 g1674341 GT9_orf434 new_conf, similar to cobalt transport membrane protein     Transporter, ABC superfamily; cobalt transporter subunit; MG181 MPN431 sp: 1..42; tm: 67..87 252..272 384..404; lc: 46..58; new_conf Paulsen already classified as ABC transporter membrane protein; sub ABC transporter; Further homolog: MP410 and MG302 MP636 complement(786383..787687)
MPN196 235805..236536 hisT g1674340 GT9_orf243V conf, pseudouridylate synthase I     (EC 4.2.1.70) uracil + D-ribose 5-phosphate = pseudouridine 5'-phosphate + H2O MG182     exp: RNA data from ZMBH, no expression, is hypothetical ! MP635 complement(785659..786390)
MPN197 236529..238364 pepF g1674339 GT9_orf611 conf, oligoendopeptidase F       MG183       MP634 complement(783831..785666)
MPN198 238364..239323 mte1 g1674338 GT9_orf319V conf, adenine-specific methyltransferase EcoRI     (EC 2.1.1.72) S-adenosyl-L-methionine + DNA adenine = S-adenosyl-L-homocysteine + DNA 6-methylaminopurine MG184       MP633 complement(782872..783831)
MPN199 239417..241699 GT9_orf760 g1674337 GT9_orf760 see: MP631 conserved hypothetical       MG185 MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200 sp: 1..25; lc: 552..568; see comments to MP631. MP632 complement(780496..782778)
MPN200 241983..244379 GT9_orf798 g1674335 GT9_orf798 conserved hypothetical         MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN491, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN199 sp: 1..18; cc: 540..565; lc: 228..242; No significant homologs other than MP and MG. Family with 15 members. Among the members, MP002, MP336, MP430, MP547, MP551, MP631, MP632 have similarity in whole length with each other. Rest of the members, MP007, MP008, MP056, MP057, MP472, MP473, MP553, MP554, are parts of MP631 (representative). Homolog, but no orthologue in MG: MG185, MG260 exp: RNA data from ZMBH, RNA-expressed; MP631 complement(777816..780212)
MPN201 244853..245569 GT9_orf238 g1674334 GT9_orf238 conf,see: MP335         MPN089, MPN615, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285   member of a family of restriction enzymes; 1.7e-20 till res 326 to M.pulmonis restr. system; exp evidence for M.pulmonis in PNAS 95, 13923 (1998) see main representative MP335 MP630 complement(776626..777342)
MPN202 246049..246990 GT9_orf313 g1674333 GT9_orf313 conf, see: MP013         MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN286 lc: 249..268;   MP629 complement(775205..776146)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN203 246909..247292 GT9_orf127 g1674332 GT9_orf127 conf, see: MP013         MPN144, MPN141, MPN132, MPN099, MPN500, MPN409 sp: 1..22; lc: 91..105;   MP628 complement(774903..775286)
MPN204 247655..248101 GT9_orf148 g1674331 GT9_orf148 conserved hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF exp: RNA data from ZMBH, RNA-expressed; MP627 complement(774094..774540)
MPN205 248562..249878 GT9_orf438V g1674330 GT9_orf438V conf, see: MP013         MPN141, MPN128, MPN101, MPN502, MPN462, MPN370 lc: 23..38 130..139 169..191 245..259;   MP626 complement(772317..773633)
MPN206 complement(249933..250274) GT9_orf113 g1674329 GT9_orf113 hypothetical           lc: 63..78; Only the N-terminal 62 residues have similarity to M. genitalium hypothetical protein fragment (SPTREMBL Q49241; len=66) with e=1e-04, 45% identity. 63-78, SEG. exp: RNA data from ZMBH, RNA-expressed; MP625 771921..772262
MPN207 250326..253148 ptsG g1674328 GT9_orf940o conf, PTS system, glucose-specific IIABC component 664-692, PTS_EIIB (Pfam); 794-856, PTS_EIIA (Pfam) 1AX3, 1IBA transporter, PTS; sugar transport: glucose, input for glycolysis; MG069 MPN313, MPN268, MPN259 tm: 40..60 85..105 110..130 170..190 209..229 488..508 514..534 537..557 598..618; lc: 240..252 635..647; sub PTS; C, B, A domains are in a single chain in this order. MP624 complement(769047..771869)
MPN208 253758..254642 rpsB g1674326 G07_orf294 conf, ribosomal protein S2       MG070   cc: 132..160; SUB; MP623 complement(767553..768437)
MPN209 254635..257253 mgtA g1674325 G07_orf872V less, cation-transporting P-type ATPase 42-62, TM; 83-709, E1-E2_ATPase (Pfam); 736-756, TM; 771-791, TM; 80-826, TM; 839-859, TM   Transporter, P-type ATPase; cations (Mg++, Ca++) MG071   tm: 42..62 78..98 243..263 268..288 648..668 688..708 736..756 771..791 806..826 839..859; less: Mg2+ is too specific. Most of the Blast hits are cation-transporting ATPase. MP622 complement(764942..767560)
MPN210 257240..259666 secA g1674324 G07_orf808 conf, preprotein translocase SecA 6-419, SecA_protein (Pfam)     MG072     sub protein export; One of the components for protein export. Other components are: secY (MP647), secE (MP086?). The intergenic region between MP589 and MP590 seems contain the other component, secG, of this system, because the intergenic region has similarity to yvaL in Bs (FEBS Lett.445;6-8 (1999)), and yavL is similar to secG (J.Bacteriol.181(6):1786-92 (1999)). MP621 complement(762529..764955)
MPN211 259641..261614 uvrB g1674323 G07_orf657 conf, excinuclease ABC subunit B   1A1V-A   MG073 MPN443   sub excinuclease; One of the three subunits of the ABC excision nuclease. Other subunits are: uvrA (MP223) and uvrC (MP029). MP620 complement(760581..762554)
MPN212 261617..262024 G07_orf135 g1674322 G07_orf135 conserved hypothetical       MG074 MPN648 sp: 1..25; 1-25, signal peptide. Further homolog: MP194, MG441. PSI-Blast detects nothing other than these 4 homologs. exp: RNA data from ZMBH, RNA-expressed; MP619 complement(760171..760578)
MPN213 262129..265221 G07_orf1030 g1674321 G07_orf1030 conserved hypothetical       MG075   sp: 1..16; lc: 17..29 567..579 596..619 644..660 893..907; No homologs other than MG075. exp: RNA data from ZMBH, RNA-expressed; MP618 complement(756974..760066)
MPN214 complement(265218..265634) G07_orf138 g1674320 G07_orf138 conserved hypothetical       MG076 MPN046 sp: 1..42; tm: 48..68; 1-42, signal peptide; 48-68, TM; 118-138, TM. PSI-Blast detects nothing other than MG076. exp: RNA data from ZMBH, RNA-expressed; MP617 756561..756977
MPN215 265910..267079 oppB g1674318 G07_orf389a conf, oligopeptide transport system permease protein OppB     Transporter, ABC superfamily; oligopeptide transporter subunit; MG077 MPN216 sp: 1..16; tm: 85..105 116..136 161..181 221..241 265..285; sub ABC transporter; MP616 complement(755116..756285)
MPN216 267072..268202 amiD g1674317 G07_orf376 conf, oligopeptide transport system permease protein AmiD     Transporter, ABC superfamily; oligopeptide transporter subunit; MG078 MPN215 tm: 46..66 172..192 212..232 239..259 297..317 338..358; sub; MP615 complement(753993..755123)
MPN217 268204..269475 oppD g1674316 G07_orf423 conf, oligopeptide transport ATP-binding protein OppD     Transporter, ABC superfamily; oligopeptide transporter subunit; MG079 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN194, MPN193 cc: 147..179; lc: 49..66; sub; MP614 complement(752720..753991)
MPN218 269438..271993 oppF g1674315 G07_orf851 CONF, but only N- and C-term; inbetween (500AA) seg and coil     apart from big coil region (see comment): Transporter, ABC superfamily; oligopeptide transporter subunit; MG080 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN217, MPN194, MPN193 cc: 267..290 507..577; 1-160 and 650-800, are N- and C-term of ATP binding part of oligopeptide ABC transporter. inbetween contains sec and coil, and hits CYTADHERENCE and myosin hits MP526 inbetween thus ... contacted miguel about MP526 annot true but inbetween N- and C-term :oligopeptide ABC transporter ATP binding subunit, AND inbetween (500AA) sec and coil; sub; MP613 complement(750202..752757)
MPN219 272049..272462 rplK g1674314 G07_orf137 conf, ribosomal protein L11   1ACI   MG081     SUB; sub; MP612 complement(749733..750146)
MPN220 272462..273142 rplA g1674313 G07_orf226 conf, ribosomal protein L1   1AD2   MG082   lc: 122..134; SUB; sub; MP611 complement(749053..749733)
MPN221 273142..273708 pth g1674312 G07_orf188 conf, peptidyl-tRNA hydrolase   2PTH   MG083       MP610 complement(748487..749053)
MPN222 273701..274570 yacA g1674311 G07_orf289 new_conf, similar to PP-loop superfamily ATPase/cell cycle protein MESJ homologues   1GPM-A   MG084     psi blast hits PP-loop superfamily ATPase/CELL CYCLE PROTEIN MESJ HOMOLOG this gene lies very close to its neighbor (MP608) interaction at the signal transduction level ??? pent in all domains of life.; new_conf more koonin; exp: RNA data from ZMBH, only once at 32 degrees, still doubtful; MP609 complement(747625..748494)
MPN223 274571..275509 G07_orf312 g1674310 G07_orf312 new_conf, HPr(Ser) kinase       MG085   lc: 140..154; new_conf; psi-blast HPr(Ser) kinase full length 26% to MEDLINE 99121006 bettr :30% (BS true ortholog) to MEDLINE 98230327 regulates ... COG1493 latest update also states serine kinase of the HPr. protein; MP608 complement(746686..747624)
MPN224 275499..276668 lgt g1674309 G07_orf389b more__, prolipoprotein diacylglyceryl transferase but unknown TM contating C-term; bidomainal;       MG086   tm: 25..45 54..74 99..119 147..167 221..241 278..298 310..330; lc: 120..137; smart: 7 or 8 TM regions in 389 AA. 1-280 hits prolipoprotein diacylglyceryl transferase C-term hits nothing except MP ortholog, but does contain one probable TM region.; new_conf more koonin, different MG genbankk and TIGR; MP607 complement(745527..746696)
MPN225 276697..277116 rpsL g1674308 G07_orf139 conf, ribosomal protein S12       MG087   lc: 9..22; SUB; sub; MP606 complement(745079..745498)
MPN226 277170..277637 rpsG g1674307 G07_orf155 conf, ribosomal protein S7   1RSS   MG088     SUB; sub; MP605 complement(744558..745025)
MPN227 277660..279726 fus g1674306 G07_orf688 conf, elongation factor G   1DAR   MG089 MPN001, MPN665, MPN279, MPN155     MP604 complement(742469..744535)
MPN228 279783..280430 rpsF g1674305 G07_orf215 conf, ribosomal protein S6 but seg N-term       MG090   lc: 187..210; SUB; sub; MP603 complement(741765..742412)
MPN229 280430..280930 ssb g1674304 G07_orf166 conf, single-stranded DNA binding protein   3ULL-B   MG091       MP602 complement(741265..741765)
MPN230 280920..281234 rpsR g1674303 G07_orf104b conf, ribosomal protein S18       MG092   lc: 12..25; SUB; sub; MP601 complement(740961..741275)
MPN231 281237..281686 rplI g1674302 G07_orf149 conf, ribosomal protein L9   1DIV   MG093     SUB; MP600 complement(740509..740958)
MPN232 281673..283094 dnaB g1674301 G07_orf473 conf, replicative DNA helicase DnaB   1REA   MG094   lc: 133..143; exp: RNA data from ZMBH only once 32 degrees, makes sense, restr. enzyme. MP599 complement(739101..740522)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN233 283098..284462 G07_orf454 g1674300 G07_orf454 new, excreted conserved protein       MG095   sp: 1..22; lc: 47..64; psi-blast iteration hit complexity biased proteins and "antigens" from o.a. plasmodium. hits asparagine rich. lipo not completely clear to me (except for signal of course) unknown. exp: RNA data from ZMBH, RNA-expressed; MP598 complement(737733..739097)
MPN234 285190..286443 G07_orf417 g1674299 G07_orf417 new, membrane export protein family see: MP334         MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508 cc: 107..154; putative, see MP334 MP597 complement(735752..737005)
MPN235 286468..287190 ung g1674298 G07_orf240 conf, uracil DNA glycosylase   1LAU-E   MG097       MP596 complement(735005..735727)
MPN236 287388..288827 G07_orf479 g1674297 G07_orf479 more__, Glu-tRNA amidotransferase subunit C AND unknown TM contating N terminal domain; bidomainal;       MG098   tm: 16..36 61..81 106..126 133..153 176..196 229..249 290..310 333..353; new_add:We can add the TM observation and discussion; Glu-tRNA amidotransferase subunit C is addition compared to genebank MP but was found in GenebankMG and in Sternberg paper; smart 8 TM regions.; new; 479 long. C term devoid of TM. C term 353/390-479 = gatC (Glu-tRNA amidotransferase subunit C). what does the TM mean ??? (if the orf really includes the TM ...) it could also mean that the process occurs at the plasma membrane... psi-blast with only N-term/middle yields convergence on MG ortholog and with a push hits to all TM regions in NADH reductase etc. MP595 complement(733368..734807)
MPN237 288830..290266 G07_orf478V g1674296 G07_orf478V more__, Glu-tRNA amidotransferase, subunit A (gatA)       MG099   lc: 116..129; hits Glu-tRNA amidotransferase, subunit A (gatA) in psi-blast (see neighbor). hits "MEDLINE 98004482" (from BS) with 31% full length; also included in the MG update; MP594 complement(731929..733365)
MPN238 290256..291692 PET112 g1674295 G07_orf478o new_conf, Glu-tRNA(Gln) amidotransferase, subunit B (gatB)       MG100 MPN028   active in expression at the translational level. lots of the hits in psi-blast are annotated as Glu-tRNA(Gln) amidotransferase, subunit B (gatB). which it IS. hits "MEDLINE 98004482" (from BS) with 35% iden full length; new_conf MG struct other; exp: RNA data from ZMBH, only expression at 32 degree and low, but still believe, is subunit to MP 594 MP593 complement(730503..731939)
MPN239 291667..292335 K04_orf222 g1674294 K04_orf222 conserved hypothetical       MG101     converges after hitting MG ortholog. exp: RNA data from ZMBH, RNA-expressed; MP592 complement(729860..730528)
MPN240 292328..293275 trxB g1674293 K04_orf315 conf, thioredoxin reductase   1BHY Biosynthesis of cofactors, prosthetic groups and carrier; Thioredoxin; thioredoxin reductase; thioredoxin (ox) + NADPH = thioredoxin (red) + NADP; MG102 MPN390 lc: 19..34;   MP591 complement(728920..729867)
MPN241 293265..294107 K04_orf280 g1674292 K04_orf280 conserved hypothetical       MG103     converges on hypotethicals in BS, MG, TB and streptomyces exp: RNA data from ZMBH, RNA-expressed; MP590 complement(728088..728930)
MPN242 294140..294370   New identified New identified SecG               589-590 complement(727825..728055)
MPN243 294381..296561 vacB g1674290 K04_orf726 new_conf, 3'-5' exoribonuclease, RNase R   1SRO transcription - degradation of RNA MG104   cc: 597..628; new_conf, RNAse R is new; GenebankMG "viral assoc" Sternberg "cold shock DNA binding like" smart: Pfam:RNB 186-556, 597-629 COIL, 641-726 S1 pfam_rnb, The function of this region of similarity is uncertain S1 = Ribosomal protein S1-like RNA-binding domain but indirectly (via prosite + psi-blast) linked to ribonuclease family ... annotation (vacB) points in virulence direction quite correctly, (although first 80 AA hit nothing althoug there might be space for that) vacB = virulence gene, postranscriptional regulator. ribonuclease family?; exp:_COLI 98269059 show for this homologous sequence however, that it it IS a 3'-5' exoribonuclease, RNase R; confirmed also by latest COG update 0537 exoribonuclease; MP589 complement(725634..727814)
MPN244 296561..297169 K04_orf202 g1674289 K04_orf202 conserved hypothetical       MG105   sp: 1..34; hits other hypotheticals in eubacteria and archaea. 202 long. converges on hypotheticals. exp: RNA data from ZMBH, RNA-expressed; MP588 complement(725026..725634)
MPN245 complement(297138..297788) def g1674288 K04_orf216 CONF, but excreted ?   1DFF   MG106   sp: 1..24; smart signal peptide, and Pfam:Pep_deformylase 40 188 of 216 true. but signal peptide !! in front, excreted ?? MP587 724407..725057
MPN246 297610..298329 gmk g1674287 K04_orf239 less, see comments; membrane-associated guanylate kinase homologue   1GKY Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis; if 5'guanylate kinase than ATP + GMP = ADP + GDP. Note: works also with deoxy. if not, see comment, than protein binding, membrane associated; MG107   sp: 1..30; cc: 187..209; lc: 34..49; but if membrane associated: So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions. MP586 complement(723866..724585)
MPN247 298329..299108 ptc1 g1674286 K04_orf259 conf, protein phoshatase 2C homolog; similar to Swiss-Prot Accession Number P35182, from S. cerevisiae   1A6Q   MG108       MP585 complement(723087..723866)
MPN248 299099..300268 K04_orf389 g1674285 K04_orf389 less, Ser/Thr/Tyr protein kinase   1APM-E   MG109   tm: 360..380; smart: STYKc 15-309 TM 360-380. == Protein kinase; unclassified specificity true only hits this in psi-blast, but can be Ser/Thr/Tyr kinase thus not serine/threonine, but Ser/Thr/Tyr; less; MP584 complement(721927..723096)
MPN249 300255..301091 yjeQ g1674284 K04_orf278L conserved hypothetical, 154-190 similar to GTP/ATP binding proteins       MG110     hits family of hypothetical proteins in eubacteria hits after iteration the gtp/atp binding sites of other proteins with 154-190 ... -> possible gtp/atp binding; new; exp: RNA data from ZMBH, no expression, is hypothetical ! MP583 complement(721104..721940)
MPN250 301113..302405 pgiB g1674283 K04_orf430 conf, but first 70 AA     Energy metabolism, Glycolysis; phosphoglucose isomerase B (pgiB); glucose 6-phosphate = fructose 6-phosphate; MG111   tm: 384..404; only hits glucose 6-phosphate isomerase first 70 only hit MG and nothing else ... annotation is true, but first 70 .... ?? MP582 complement(719790..721082)
MPN251 302383..303030 cfxE g1674282 K04_orf215L conf, D-ribulose-5-phosphate 3 epimerase     Energy metabolism, Sugars; D-ribulose-5-phosphate 3 epimerase (cfxE); D-ribulose 5-phosphate = D-xylulose 5-phosphate; MG112       MP581 complement(719165..719812)
MPN252 303037..304404 asnS g1674281 K04_orf455o conf, asparaginyl-tRNA synthetase   1ASY-A   MG113 MPN046, MPN277     MP580 complement(717791..719158)
MPN253 304361..305044 pgsA g1674280 A65_orf227 conf, phosphatidylglycerophosphate synthase     Fatty acid and phospholipid metabolism; phosphatidylglycerophosphate synthase (pgsA); CDP-diacylglycerol + glycerol 3-phosphate = CMP + 3-(3-phosphatidyl)-glycerol 1-phosphate; MG114   tm: 30..50 59..79 112..132 160..180 194..214;   MP579 complement(717151..717834)
MPN254 305066..305539   New identified New identified conserved hypothetical               578-579 complement(716656..717129)
MPN255 305565..306320 A65_orf251b g1674278 A65_orf251b conserved hypothetical       MG116 MPN269   psi-blast converges after hitting MG ortholog. exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP578 complement(715875..716630)
MPN256 306313..306984 A65_orf223 g1674277 A65_orf223 conserved hypothetical       MG117     hits MG ortholog and then converges. exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP577 complement(715211..715882)
MPN257 306965..307981 galE g1674276 A65_orf338 conf, UDP-glucose 4-epimerase   1BXK-A Purines, pyrimidines, nucleosides and nucleotides, Sugar-nucleotide biosynthesis and conversions; UDP-glucose 4-epimerase ; UDP-glucose = UDP-galactose . MG118     exp: RNA data from ZMBH, no expression, is hypothetical; re-check why not expressed ! MP576 complement(714214..715230)
MPN258 307996..309714 yjcW g1674275 A65_orf572 more_, sugar (ribose/galactose) ABC transporter ATP-binding subunit     Transporters, ABC superfamily; ribose/galactose transport, subunit; MG119 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN609, MPN433, MPN432, MPN416, MPN334, MPN218, MPN217, MPN194, MPN193   smart: Pfam:ABC_tran 33-229 AND 355-550 (of 572)., which is the ATP-binding subunit of an ABC transporter. No TM in the protein. most hits are for ribose/galactose. Piece of sequence from 320-360 is "insterted" in the mycoplasma gene ... GALACTOSIDE as substrate experimentaly in E. coli ... stick with "sugar"; more_; sub ABC transporter; exp: RNA data from ZMBH, RNA-expressed; MP575 complement(712481..714199)
MPN259 309731..311284 A65_orf517 g1674274 A65_orf517 new_conf, sugar (ribose/galactose) ABC transporter permease subunit, but C-term ???     Transporters, ABC superfamily; ribose/galactose transport, subunit; MG120 MPN260 tm: 33..53 81..101 104..124 135..155 164..184 217..237 267..287 302..322 325..345 349..369; cc: 490..515; 517 AA long. 10 TM according to smart. apart from full length hits to MG and Mycoplasma fermentans, Hits to the first 360 AA. Homologs to MP573 with the first 350. first thing the N terminus thus hits are ribose/galactose like ABC transporters ... nice TRUE orthologs are also neighbors. (bv :BS3151 BS3150) rbsC-1, permease protein. C term tail evolves very fast (if only blasting with C-term does not find C-term Mycoplasma fermentans.) C-term ??; new_conf different koonin and genbank MG; sub ABC transporter; MP574 complement(710911..712464)
MPN260 311284..312219 rbsC g1674273 A65_orf311 conf, sugar (ribose/galactose) ABC transporter permease subunit     Transporters, ABC superfamily; ribose/galactose transport, subunit; MG121 MPN259 sp: 1..31; tm: 41..61 75..95 149..169 198..218 228..248 251..271 279..299; smart: 7-9 TM, long signal pep containing probable TM. 311 long. ABC transporter, 9 TM according to hits to swissprott. For some sugar (ribose/galactose); less; sub ABC transporter; MP573 complement(709976..710911)
MPN261 312256..314391 topA g1674272 A65_orf711 conf, DNA topoisomerase I   1ECL   MG122   lc: 58..69;   MP572 complement(707804..709939)
MPN262 314381..315808 A65_orf475 g1674271 A65_orf475 conserved hypothetical, similar to reticulocyte binding protein       MG123   sp: 1..44; 475 AA. smart: signal 1-40 probable TM in 20-40 ... after many iterations -> myosins Hits at first nothing except its MG homolog. Thereafter (i)the RETICULOCYTE BINDING PROTEIN comes in (a huge plasmodium protein) this protein should be involevd in the specific binding to and and recognition of target cells ... (ii) Dictyostelium discoideum containing leucine zipper-like domains and a AQ protein (aq_1732) with no annotation at all., except for signal and lots of SEG. all hits could be false positives (low complexity guys) MP571 complement(706387..707814)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN263 315874..316182 trx g1674270 A65_orf102 conf, thioredoxin   1AIU Biosynthesis of cofactors, prosthetic groups and carrier; Thioredoxin;thioredoxin;redox substrate; MG124       MP570 complement(706013..706321)
MPN264 316194..317039 A65_orf281 g1674269 A65_orf281 new_conf, 150-end, similar to phosphate hydrolising       MG125 MPN427, MPN383 lc: 3..14; 281 AA; smart: Pfam:DUF3 4-265. = "Domain apparently occurring exclusively in eubacteria. Unknown function." many homologs; all unknown function. after iteration 2 the phosphoserine phosphatase (first) and transportATPase come in ... the phosphoserine phosphatase hits are in the 200-end region ... the transportATPase more 150-end ... orthophospate removing ... hydrolase of phospahte binding ...; new_conf koonin MG; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP569 complement(705156..706001)
MPN265 complement(317047..318087) trpS g1674268 A65_orf346 conf, tryptophanyl-tRNA synthetase   1TYA-E   MG126       MP568 704108..705148
MPN266 318144..318581 ygl1 g1674267 A65_orf145 new_conf, similar to (oxido/arsenate) reductase       MG127     hits first hypo'd then (after it.) ARSENATE REDUCTASE ... all ARSENATE REDUCTASE are more similar to each other th;an to the small family of hypo's containing MP567 ... -> (oxido) reductase ... some species (for exa EC) contain the real ARSENATE REDUCTASE and the MP567 ortholog.;new_conf koonin MG; exp: RNA data from ZMBH, RNA-expressed; MP567 complement(703614..704051)
MPN267 318581..319360 A65_orf259 g1674266 A65_orf259 conserved hypothetical       MG128     hits full length (259) all kinds of hyotheticals in all kinds of organisms ... ultimatly converges only on hypo's ... exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP566 complement(702835..703614)
MPN268 319360..319713 A65_orf117 g1674265 A65_orf117 new_conf, similar to PTS system: EIIB and N-term part of EIIC; bidomainal;   1IBA   MG129 MPN207 sp: 1..26; hits of course first MG ortholog then hits PTS system II, first hits are to glucose specific ... NOT EIIA DOMAIN, is EIIB DOMAIN ... and 30 AA cterm of EIIC oid. can be reciprocally found by iterative psi-blast. contains probably phosphorylation site. pdb hit = pdb 1IBA; to be phosphyrilated Cysteine aligns with serine ?? and is thus not conserved. remember hits are not obvious, are distant. partial homolog = MP624. IIC is supposed to bind and transport the suger. seems true orthology because of lack of alternatives in MP ... First 20AA are according to annotated psi-blast hits TM. But not according to smart.;new_conf koonin, EMBL MG, EMBL structure, genbank MG; sub PTS system; MP565 complement(702482..702835)
MPN269 319703..321184 ysr1 g1674264 A65_orf493 conf, nucleotide binding protein       MG130   sp: 1..41; cc: 63..94; 493 AA, smart long signal (40), this signal in its last 20AA contains probable TM. 63 95 coils ... Second iteration -> myosins ... C term hits hypotheticals (clear family in eubact) and then coiled mess. ?; Iterations of pis-blast with N-term hit different nucleotide binding proteins. exp: RNA data from ZMBH, RNA-expressed; MP564 complement(701011..702492)
MPN270 321187..321474   New identified New identified conserved hypothetical               563-564 complement(700721..701008)
MPN271 321736..322491 A65_orf251a g1674262 A65_orf251a see: MP199 conserved hypothetical         MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN332 sp: 1..31;   MP563 complement(699704..700459)
MPN272 324197..324478   A65_orf94 A65_orf94 hypothetical               MPN272 complement(697717..697998)
MPN273 complement(324455..324889) hit1 g1674261 A65_orf144 new_conf, nucleotidyl hydrolases/transferase   1GUP-A   MG132     BELONGS TO THE HIT FAMILY -> histidine triad -> unifying the HIT family as nucleotidyl hydrolases, transferases, or both. Also called PROTEIN KINASE C INHIBITOR omni-pent family; new_conf EMBL structure, as well as described by Sternberg; exp: RNA data from ZMBH, RNA-expressed; MP562 697306..697740
MPN274 complement(324858..325658) A65_orf266 g1674260 A65_orf266 new, ABC transporter (sulfate/molybdenum) permease subunit       MG133 MPN666 sp: 1..40; tm: 89..109 151..171 232..252; smart: very long signal peptide. 3 or 5 TM regions ... only 266 AA long. part of signal might also be TM -> probably at least 4 TM first hits only MG orthologs + MP and MG homologs (see also MP homolog: MP176) after a while start hitting TRANSPORTERS. ABC/SULFATE(full)/MOLYBDENUM(start at 70) hits translocation; sub ABC transporter; new; MP561 696537..697337
MPN275 325680..325982 yaaK g1674259 A65_orf100 conserved hypothetical       MG134     SMART: nothing (its is short 100AA) nice family of hypotheticals can be founs after iterations. hits very vaguely a putative cytoplasmic protein ... hits nothing else except family members form different species and then converges. exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP560 complement(696213..696515)
MPN276 complement(325954..326811) A65_orf285 g1674258 A65_orf285 conserved hypothetical       MG135   tm: 31..51 84..104 108..128 150..170 173..193 236..256; 6 TM regions in a 285 AA prot .. only hits MG and (Mycoplasma gallisepticum) and then converges ... exp: RNA data from ZMBH, RNA-expressed; MP559 695384..696241
MPN277 326856..328325 lysS g1674257 A65_orf489 conf, lysyl-tRNA synthetase   1LYL-A   MG136 MPN046, MPN252     MP558 complement(693870..695339)
MPN278 328285..329484 yefE g1674256 A65_orf399V new_conf, udp-galactopyranose mutase   1AOG-A   MG137     smart: nothing UDP-GALACTOPYRANOSE MUTASE full length hit to experminetal determined GLF_ECOLI; new_conf differnt/more than TIGR koonin; new_conf exactly this in swiss prot; UI 96165258; MP557 complement(692711..693910)
MPN279 329484..331229 lepA g1674255 A65_orf581 conf, GTP-binding membrane protein LepA   1AIP, 2EFG-A   MG138 MPN665, MPN481, MPN227, MPN155     MP556 complement(690966..692711)
MPN280 331360..333069 A65_orf569 g1674253 A65_orf569 new, similar to single stranded RNA(DNA) processing enzymes   1BC2-A   MG139 MPN621 lc: 32..47; new; SMART: 18 223 Pfam:lactamase_B superfamily thing hits distantly putative single strand RNA/DNA editing enzymes ... see also C12_orf561 !, is family of unknowns in eubacteria and archaea CLEAVAGE AND POLYADENYLATION and ATP binding start to surface ... hits 14-434 (of 569) in bos taurus MEDLINE 97078155; new, differnt from koonin and tobias; cons. hyp GenebankMG; Zn metallo-beta-lactamase Sternberg; COG595 predicts metal hydrolase 3; (consistent with our prediction, we think we can be more specific;) MP555 complement(689126..690835)
MPN281 333280..334413 A65_orf377 g1674252 A65_orf377 see: MP631 conserved hypothetical         MPN152, MPN147, MPN146, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN200, MPN199 sp: 1..21; lc: 246..258; see comments to MP631. MP554 complement(687782..688915)
MPN282 334768..335268 A65_orf166 g1674251 A65_orf166 see: MP631, conserved hypothetical         MPN152, MPN147, MPN098, MPN097, MPN506, MPN408, MPN364, MPN288, MPN284, MPN200, MPN199 lc: 57..70; see comments to MP631. MP553 complement(686927..687427)
MPN283 336479..336826 A65_orf115 g1674250 A65_orf115 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 lc: 43..55; URF exp: RNA data from ZMBH, RNA-expressed; MP552 complement(685369..685716)
MPN284 337770..340154 A65_orf794 g1674249 A65_orf794 see: MP631 conserved hypothetical       MG260 MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN282, MPN281, MPN200, MPN199 sp: 1..18; lc: 218..236 462..475; see comments to MP631. MP551 complement(682041..684425)
MPN285 340613..341533 prrB g1674248 A65_orf306 conf, type I restriction enzyme ecokI specificity protein see: MP335         MPN089, MPN638, MPN615, MPN567, MPN507, MPN365, MPN343, MPN290, MPN289, MPN201 lc: 26..87; member of a family of restriction enzymes; 1.7e-20 till res 326 to M.pulmonis restr. system; exp evidence for M.pulmonis in PNAS 95, 13923 (1998) MP550 complement(680662..681582)
MPN286 341636..343033 A65_orf465V g1674246 A65_orf465V conf, see: MP013         MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN202 lc: 20..37 59..71 111..131 157..171 257..281 389..401;   MP549 complement(679162..680559)
MPN287 343764..344120 A65_orf118 g1674245 A65_orf118 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URFexp: RNA data from ZMBH, RNA-expressed; MP548 complement(678075..678431)
MPN288 344716..347079 A65_orf787o g1674244 A65_orf787o see: MP631 conserved hypothetical         MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN284, MPN282, MPN281, MPN200, MPN199 sp: 1..27; cc: 537..557; lc: 231..267 467..479; see comments to MP631. exp: 2D-Gel data from ZMBH TX-UF, auf Gel ca. 31 kD, IEP 5.6; RNA data from ZMBH only once at 32 degrees; MP547 complement(675116..677479)
MPN289 347169..347732 hsdS1B g1674243 H10_orf187V conf, this protein specifications means only that it is a type I restriction with enzyme ecokI specificity protein see: MP335         MPN089, MPN615, MPN507, MPN365, MPN343, MPN290, MPN285, MPN201 lc: 149..166; family, see main representative MP335 MP546 complement(674463..675026)
MPN290 347871..348308 H10_orf145L g1674242 H10_orf145L conf,see: MP335         MPN089, MPN615, MPN507, MPN365, MPN343, MPN289, MPN285, MPN201   family, see main representative MP335 MP545 complement(673887..674324)
MPN291 complement(348301..348891) H10_orf196 g1674241 H10_orf196 conserved hypothetical       MG208 MPN478   hits only MG counterpart exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP544 673304..673894
MPN292 complement(348875..349804) yceC g1674240 H10_orf309 new_conf, similar to RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D       MG209 MPN548 lc: 144..156; SUB; mart: PFAM: YABO = hypthetical function hits (also links of YABO) to RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D ... hits to experimentaaly confirmed RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D; exp in EC seem VERY significant after one iteration UI 98325071; new_conf tobias MG; exp: RNA data from ZMBH, RNA-expressed; MP543 672391..673320

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN293 complement(349804..350358) lsp g1674239 H10_orf184 conf, prolipoprotein signal peptidase       MG210   sp: 1..47; tm: 92..112 156..176; 20-160 (of 180) indeed true as given prolipoprotein signal peptidase MP542 671837..672391
MPN294 350397..351017 H10_orf206 g1674238 H10_orf206 new_conf, similar to intracellular protease             Hits after iterations: PFPI_PYRFU a PROTEASE, belonging to the THIJ/PFPI FAMILY PFPI_PYRFU contains hard medline refernce ... but hits many other proteins after that iteration ... (rna binding AND -methyl-5(b-hy droxyethyl -thiazole monophosphate biosynthesis enzyme) ...proteases appaer first by a big significance differnce. actually all the putative functions are one big family ... MP is most similar to protease, seems to fall in that COG (is remotely similar to MP122 (B01_orf108), hydrolase), hits medline 96196168; new_conf, confirmed also by putative intracellular protease, COG 0693; MP541 complement(671178..671798)
MPN295 351066..351728 H10_orf220L g1674237 H10_orf220L conserved hypothetical       MG210.1     only hits the MG ortholog and then CONVERGES ..... REALLY smart: SEG exp: RNA data from ZMBH, RNA-expressed; 2d-Gel-PH: TX-UF. Ges.; MP540 complement(670467..671129)
MPN296 351728..351910   New identified New identified ribosomal protein S21               539-540 complement(670285..670467)
MPN297 351935..352384 H10_orf149 g1674235 H10_orf149 conserved hypothetical       MG211   cc: 53..89; Only close homolog is from MG. Converges on that one in PSI-blast sub significant hits are all glutamate rich ... and should thus be discarded smart: coils exp: RNA data from ZMBH, RNA-expressed; 2d-Gel-PH: TX-UF; MP539 complement(669811..670260)
MPN298 352387..352746 H10_orf119 g1674234 H10_orf119 new_conf, similar to holo-acyl-carrier protein synthase       MG211.1     N term part 1-65 hits holo-acyl-carrier protein synthase ... after third ietration hits become full length. also reciprocally it is hit. [FUNCTION] TRANSFERS THE 4'-PHOSPHOPANTETHEINE MOIETY FROM COENZYME A TO THE SER-36 OF ACYL-CARRIER PROTEIN. [CATALYTIC ACTIVITY] COA + APO-[ACYL-CARRIER PROTEIN] = ADENOSINE 3',5'-BISPHOSPHATE + HOLO-[ACYL-CARRIER PROTEIN]. [COFACTOR] REQUI MG(2+). [SUBUNIT] HOMODIMER. IF it is anything it is likely something like this, hits medline 96027548; new_conf, COG0736, acyl carrier protein synthase; MP538 complement(669449..669808)
MPN299 352734..353534 plsB g1674233 H10_orf266 conf, 1-acyl-sn-glycerol-3-phosphate acyltransferase     Fatty acid and phospholipid metabolism; Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate; MG212   sp: 1..39; confirmed by psi-blast (unless all false annotations or it makes no sense in context) Synonim: LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE (1-ACYLGLYCEROL- 3-PHOSPHATE O-ACYLTRANSFERASE) might be over prediction ????, context .. MP537 complement(668661..669461)
MPN300 353535..355055 dyr g1674232 H10_orf506 conf, bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical 1-157 matches completely Dihydrofolate Reductase; 160-400 matches 21-238 of bacterial family member 250 aa proteins (e.g. YPUG_BACSU); 400-506 no matches appart of MG homolog. 1VDR-A Biosynthesis of cofactors, prosthetic groups and carrier;Folic acid; but dihyrofolate reductase (DYR) homolog protein; reaction similar to 5,6,7,8-tetrahydrofolate + NADP = 7,8-dihydrofolate + NADPH MG213 MPN321 cc: 247..269 427..460; story: N-terminal matches Dihydrofolate Reductase but another part is a bacterial family of hypothetical proteins (multidomain or artifact) exp: RNA data from ZMBH, 32 degrees once, RNA-expressed; MP536 complement(667140..668660)
MPN301 355039..355665 ypuH g1674231 H10_orf208 conserved hypothetical       MG214     bacterial family; bacterial family; expandable with PSI-BLAST exp: RNA data from ZMBH, RNA-expressed; MP535 complement(666530..667156)
MPN302 355685..356671 pfk g1674230 H10_orf328 conf, 6-phosphofructokinase   3PFK Energy metabolism, Glycolysis; 6-phosphofructokinase (pfk); fructose 6-phosphate + ATP = Fructose 1,6-biphosphate; note: This twin MP533/MP534 (other glycolysis twin MP213/MP214) - evolutionary implications ? regulation ? MG215       MP534 complement(665524..666510)
MPN303 356677..358203 pyk g1674229 H10_orf508 conf, pyruvate kinase   1A3W-A Energy metabolism, Glycolysis;pyruvate kinase (pyk); phosphoenol pyruvate and ADP = pyruvate + ATP; MG216       MP533 complement(663992..665518)
Cys-tRNA(TGC) 358241..358319 mptgc                     358241..358319 complement(663876..663954)
Pro-tRNA(CCA) 358371..358447 mptgc                     358371..358447 complement(663748..663824)
Met-tRNA(ATG) 358456..358528 mptgc                     358456..358528 complement(663667..663739)
Ile-tRNA(ATG) 358539..358614 mptgc     in Genbank, /note="codon recognized: CAT" is wrong.               358539..358614 complement(663581..663656)
Ser-tRNA(TCA) 358655..358745 mptgc                     358655..358745 complement(663450..663540)
fMet-tRNA(ATG) 358758..358834 mptgc     in Genbank, /product="tRNA-Met" is wrong.               358758..358834 complement(663361..663437)
Asp-tRNA(GAC) 358836..358909 mptgc     in Genbank, /product="tRNA-Asn" is wrong.               358836..358909 complement(663286..663359)
Phe-tRNA(TTC) 358911..358986       in Genbank, "gene" missing. Maybe gene = "mptgc"               358911..358986 complement(663209..663284)
MPN304 359183..359899 arcA g1674228 H10_orf238 less, (N-terminal, fragment)     Energy metabolism; Amino acids and amines; N-terminal fragment; arginine + H2O = citrullin + NH3; note with MP531 above only; there is another arginine deiminase or arginine dehydrolase at MP 282;   MPN560   matches ARCA_MYCAR 4-194; exp: Chromosomal and other re-sequencing suggests that this frameshift is real; the fragments here are probably pseudogenes (subsequent loss) and/or in the process of acquiring a new function MP532 complement(662296..663012)
MPN305 359800..360396 arcA g1674227 H10_orf198 less, (C-terminal, fragment)     Energy metabolism; Amino acids and amines; C-terminal fragment; arginine + H2O = citrullin + NH3   MPN560   matches ARCA_MYCAR 210-407; exp: Chromosomal and other re-sequencing suggests that this frameshift is real; there is MP282 as a complete arginine deiminase; the fragments here are probable pseudogenes(subsequent loss) and/or in the process of acquiring a new function MP531 complement(661799..662395)
MPN306 360644..361465 argI g1674226 H10_orf273o less (fragment)   1A1S Energy metabolism, Amino acids and amines; if the first 70 AA do not matter (see comment) this works as ornithine carbamoyl transferase (otc1); carbamoyl-phosphate + ornithine = phosphate + citrulline;       first 70 aa of the ornithine carbamoyl transferase are not matched (sequence-error?); Mikita has an N-terminal extension; MP530 complement(660730..661551)
MPN307 361468..362397 arcC g1674225 F10_orf309 conf, carbamate kinase (EC 2.7.2.2)     Energy metabolism, Amino acids and amines; carbamate kinase; ATP + NH3 + CO2 = ADP + carbamoyl-phosphate;     lc: 185..191 287..300;   MP529 complement(659798..660727)
MPN308 362400..364097 F10_orf565 g1674224 F10_orf565 new_conf, aa_permeases see: MP058     Transporters, probably APC family like; amino acid permease   MPN096, MPN095 sp: 1..23; tm: 43..63 95..115 137..157 172..192 227..247 268..288 311..331 371..391 424..444 460..480 515..535; new_conf; Pfam:aa_permeases (Evalue - 0.64) See pfam alignment. further confirmed by COG531 MP528 complement(658098..659795)
MPN309 364231..365448 P65 g1674222 F10_orf405 conserved hypothetical       MG217 MPN452 cc: 253..319; lc: 52..72; less: P65 is not a function, it is hypothetical; only homologs in MP and MG exp: RNA data from ZMBH, RNA-expressed; part of the cytadherence regulatory locus protein with MW 65 kDa. cytadherence operon-like MP527 complement(656747..657964)
MPN310 365468..370924 F10_orf1818 g1674221 F10_orf1818 new_conf, Cytadherence High Molecular Weight Protein 2 (SwissProt HMW2_MYCPN)       MG218 MPN474, MPN387 cc: 39..69 102..177 256..285 314..562 618..865 926..1068 1173..1273 1367..1416 1503..1606 1644..1755 1787..1814; lc: 1756..1784; new_conf; this protein is HMW2_MYCPN 97252497 J. BACTERIOL. 179:2668-2677(1997); koonin said only coiled coil; most of the protein is coiled coil; hmw2 recognized also by Sternberg, GenebankMG and swissprot; note that this protein is the center of the crl, the cytadherence regulatory locus; Hedreyda and Krause, 1995; Infect.Immun 63, 3479-3483. Tn4001 insertions in crl have a polar effect on the expression of flanking genes and also result in loss of HMW1 and HMW3 and a cytadherence negative phenotype; cytadherence operon-like; MP526 complement(651271..656727)
MPN311 370939..372012 F10_orf357 g1674220 F10_orf357 conserved hypothetical       MG218.1   cc: 196..220; lc: 57..70 289..317; only a MG homolog exp: RNA data from ZMBH, 32 degrees,RNA-expressed; cytadherence regulatory locus protein with MW 41 kDa; cytadherence operon-like MP525 complement(650183..651256)
MPN312 372002..372658 F10_orf218 g1674219 F10_orf218 hypothetical           lc: 107..132; no homologue; URF, although according to Krause et. al. J. Bact 1997 2668-2677 there is a protein expressed (bs); exp: RNA data from ZMBH, RNA-expressed; cytadherence regulatory locus protein with MW 24 kDa; cytadherence operon-like MP524 complement(649537..650193)
MPN313 complement(372741..373013) F10_orf90 g1674218 F10_orf90 conserved hypothetical       MG220 MPN207 tm: 12..32; Only homolog in MG by PSI-BLAST; Homolog in MG, GeneBank and TYGR say pre-procytotoxin (?), Koonin says hypothetical exp: RNA data from ZMBH, 32 degrees,RNA-expressed; MP523 649182..649454
Arg-tRNA(CGC) 373083..373159 mptgac                     373083..373159 complement(649036..649112)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN314 373414..373839 yabB g1674217 F10_orf141b conserved hypothetical       MG221     Conserved bacterial family exp: RNA data from ZMBH, RNA-expressed; MP522 complement(648356..648781)
MPN315 373829..374755 yabC g1674216 F10_orf308 new_conf, SAM-Dependent Methytransferase (Koonin for MG ortholog)       MG222   lc: 180..192; new_conf Koonin for MG ortholog; 2nd PSI-BLAST iteration hits characterized members MTA1_ACICA 91345839 Agric. Biol. Chem. 55 (6), 1553-1559 (1991); exp MTA1_ACICA 91345839 exp: RNA data from ZMBH, RNA-expressed; MP521 complement(647440..648366)
MPN316 374758..376017 F10_orf419 g1674215 F10_orf419 conserved hypothetical       MG223   lc: 328..342; only MP MG exp: RNA data from ZMBH,RNA-expressed; MP520 complement(646178..647437)
MPN317 376023..377165 ftsZ g1674214 F10_orf380 conf, cell division protein FtsZ   1FSZ   MG224     exp: RNA data from ZMBH only once low at 32 degrees, is hypothetical ! Why: Because only activated at cell division. MP519 complement(645030..646172)
MPN318 377208..378683 F10_orf491 g1674213 F10_orf491 conf,(amino acid permease)     Transporters, APC family; amino acid permease; MG225 MPN319 tm: 12..32 39..59 98..118 129..149 163..183 203..223 241..261 288..308 347..367 380..400 421..441 453..473; homologue to MP517 exp: RNA data from ZMBH,RNA-expressed; MP518 complement(643512..644987)
MPN319 378658..380169 gap1 g1674212 F10_orf503 conf, general amino acid permease GAP1 homolog; similar to Swiss-Prot Accession Number P19145, from S. cerevisiae     Transporters, APC family; amino acid permease; MG226 MPN318 tm: 20..40 46..66 106..126 136..156 166..186 210..230 247..267 301..321 360..380 406..426 443..463 468..488; homologue to MP518 MP517 complement(642026..643537)
MPN320 380541..381527 thyA g1674210 F10_orf328 conf, thymidylate synthase   1AN5-A   MG227     Bairoch: Protein starts in fact at MQQYLDLARYVLEHGKYRP ... so about 40 aa shorter at N-terminus; Mikita sees again only a one bp intergenic region (but not more). MP516 complement(640668..641654)
MPN321 381529..382011 dhfr g1674209 F10_orf160 conf, dihydrofolate reductase (EC 1.5.1.3)   1DDR-A Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; dihydrofolate reductase (dhfr); 5,6,7,8-tetrahydrofolate + NADP = 7,8-dihydrofolate + NADPH; MG228 MPN300     MP515 complement(640184..640666)
MPN322 382018..383037 nrdF g1674208 F10_orf339 more_, ribonucleoside-diphosphate reductase beta chain   1MRR-A Purines, pyrimidines, nucleosides and nucleotides, 2'-Deoyribonucleotide metabolism; ribonucleoside-diphosphate reductase (nrdE); requires further subunit, but MP514 is in such an operon, see comment; 2'-deoxyribonucleoside diphosphate + oxidized thioredoxin +H2O = ribonucleoside diphosphate + reduced thioredoxin; MG229   lc: 178..192; more_ beta subunit; sub: ribonucleoside-diphosphate reductase; operon MP512/MP513/MP514 MP514 complement(639158..640177)
MPN323 383040..383501 F10_orf153 g1674207 F10_orf153 new_conf, probably nrdI       MG230     tentative but part of a ribonucleoside-diphosphate reductase operon present also in E. coli, B. subtilis, S. typhimirium, L. lactis, etc; homolog (no function) NRDI_BACSU 97124182 MICROBIOLOGY 142:2995-3004(1996) operon MP512/MP513/MP514; operon comparison in 98136125 J. Biol. Chem. 273:4329-4337(1998) Figure 2; COG1780; Sternberg; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP513 complement(638694..639155)
MPN324 383525..385690 nrdE g1674206 F10_orf721 more_, ribonucleoside-diphosphate reductase alpha chain   5R1R-A Purines, pyrimidines, nucleosides and nucleotides, 2'-Deoyribonucleotide metabolism; ribonucleoside-diphosphate reductase (nrdE); requires further subunit, but MP512 is in such an operon, see comment; 2'-deoxyribonucleoside diphosphate + oxidized thioredoxin +H2O = ribonucleoside diphosphate + reduced thioredoxin; MG231     more_ alpha subunit; sub: ribonucleoside-diphosphate reductase; operon MP512/MP513/MP514 MP512 complement(636505..638670)
MPN325 385837..386139 rpl21 g1674205 F10_orf100b conf, ribosomal protein L21       MG232     SUB; sub: ribosomal MP511 complement(636056..636358)
MPN326 386132..386434 ysxB g1674204 F10_orf100a conserved hypothetical       MG233   tm: 24..44; small bacterial family with members in MP MG B. subtilis and T. pallidum exp: RNA data from ZMBH, RNA-expressed; MP510 complement(635761..636063)
MPN327 386427..386741 rpl27 g1674203 F10_orf104 conf, ribosomal protein L27       MG234     SUB; sub: ribosomal MP509 complement(635454..635768)
MPN328 386734..387594 nfo g1674202 F10_orf286 conf, endonuclease IV   1DID-A, 1BHW-A   MG235       MP508 complement(634601..635461)
MPN329 387548..388024 F10_orf158 g1674201 F10_orf158 new_conf, Ferric uptake regulator (Koonin for MG homologue)       MG236     new_conf (Koonin for MG homologue); exp 98164360 FUR_HELPY MP507 complement(634171..634647)
MPN330 388014..388898 F10_orf294 g1674200 F10_orf294 conserved hypothetical       MG237     exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP506 complement(633297..634181)
MPN331 388923..390257 tig g1674199 F10_orf444 conf, trigger factor   1BKF   MG238     exp,expPH: N-terminal sequence was MKQYNTDNTE [instead of of predicted MKQYKLVNTTQKE] 2D Gel weight was 55kD instead of 51kD predicted MP505 complement(631938..633272)
MPN332 390328..392715 lon g1674198 F10_orf795 conf, ATP-dependent protease Lon   1D2N-A   MG239 MPN271 lc: 33..47 304..308 591..604;   MP504 complement(629480..631867)
MPN333 392910..395162 F10_orf750 g1674196 F10_orf750 hypothetical see: MP501         MPN491, MPN335 sp: 1..49; tm: 79..99 118..138 143..163 724..744; cc: 546..587; less: no homolog appart from MP503; no idea from where the original annotation came; exp: RNA data from ZMBH, RNA-expressed; MP503 complement(627033..629285)
MPN334 395165..396145 bcrA g1674195 F10_orf326 new_conf, ABC transporter ATP-binding protein     Transporter, ABC family, function ?;   MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN258, MPN218, MPN217, MPN194, MPN193   new_conf pfam 35-215 Pfam:ABC_tran; C-terminal 80 residues not conserved (not even in MG), probably missing stop codon; exp 96146051 ECSA_BACSU MP502 complement(626050..627030)
MPN335 396132..398357 F10_orf741 g1674194 F10_orf741 hypothetical see: MP503         MPN491, MPN333 tm: 38..58 73..93 120..140 157..177 185..205 715..735; cc: 404..431 626..647; lc: 222..234 440..467 552..566 603..625; less: no homolog appart from MP503; no idea from where the original annotation came; exp: RNA data from ZMBH, RNA-expressed; MP501 complement(623838..626063)
MPN336 complement(398358..399392) F10_orf291 g1674193 F10_orf291 new_conf, bidomain: nucleotidyl transferase and conserved hypo-thetical second domain, probably phosphopantetheine adenylyltransferase activity 1-130 conserved archaeal/bacterial proteins with similarity to LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN and nucleotidyl transferases; 131-291 family of archaeal/bacterial proteins of unknown function   Fatty acid and phospholipid metabolism; phosphopantetheine adenylyltransferase (rate limiting step in CoA synthesis) ATP + pantetheine 4'phosphate <-> diphosphate + dephospho-Coenzyme A (CoA) MG240   lc: 265..277; new_conf; N-terminal family of archaeal/bacterial proteins with similarity to nucleotidyl transferases and "LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS (exact function see below)" PROTEIN KDTB PSI-BLAST kdtb_ecoli 92250420 J. BACTERIOL. 174:3250-3260(1992); story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon; further support: common regulation of mRNA expression) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; Note: The operon is overall very similarly expressed, around 400 at 32 degrees, good exp. argument; cog1713 (given in the MG re-annotation update) is "Uncharacterized BCR"; however COG1057 (latest COG page) confirms the nucleotidyl transferase prediction. Exp. Data by Iszard and Geerlof (1999) EMBO show exact function of ktdb E.coli is phosphopantetheine adenylyltransferase; this could use the 4'phosphopantehteine created by the acyl carrier protein phospho diesterase (MP362). Participation in lipid metabolism via this CoA link MP500 622962..623837
MPN337 399477..401342 F10_orf621 g1674192 F10_orf621 conserved hypothetical       MG241 MPN338 tm: 588..608; lc: 247..262 480..496; story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP499 complement(620853..622718)
MPN338 401345..403243 F10_orf632o g1674191 F10_orf632o conserved hypothetical       MG242 MPN337 tm: 571..591 603..623; cc: 322..355; story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP498 complement(618952..620850)
MPN339 403243..403917 H91_orf224 g1674190 H91_orf224 conserved hypothetical           sp: 1..47; tm: 54..74 108..128 153..173; story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP497 complement(618278..618952)
MPN340 403921..405510 pcrA g1674189 H91_orf529 conf,DNA helicase II   1PJR     MPN341 tm: 506..526; less; Similar to previous one but without the C-terminal domain; Pfam:UvrD-helicase 5-469 exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP496 complement(616685..618274)
MPN341 405573..407720 mutB1 g1674187 H91_orf715 more__, DNA helicase II (with Mycoplasma specific C-terminal domain) 1-620 similarity to DNA helicases II, PCRA_STAAU 94049679 Mol. Gen. Genet. 241 (1-2), 185-192 (1993); 640-728 uncharacterised C-terminal domain specific of MP, MG and the shorter UVRD_MYCCA 94075343 J. Biol. Chem. 268 (35), 26531-26540 (1993) 1PJR   MG244 MPN340 cc: 575..599; lc: 680..692; Pfam:UvrD-helicase 10-488; exp PCRA_STAAU 94049679; better: E.coli 92358234 uvrD helicase II e-64 full protein, but story: this sequence has a domain specific of Mycoplasma which is not described, moreover the M capricolum protein has a different domain organization; annotation of UVRD_MYCCA could be wrong, it only matches part of DNA helicases II MP495 complement(614475..616622)
MPN342 407861..409492 hsdM g1674186 H91_orf543 conf, type I restriction enzyme HsdM   1YUB     MPN352   sub: type I restriction system; subunit M of type I restriction system; exp 89178628 T1M1_ECOLI MP494 complement(612703..614334)
MPN343 409871..410863 H91_orf330 g1674185 H91_orf330 conf,see: MP335         MPN089, MPN615, MPN567, MPN507, MPN365, MPN290, MPN289, MPN285, MPN201 lc: 46..111; family, see main representative MP335 MP493 complement(611332..612324)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN344 411086..411736 H91_orf216 g1674184 H91_orf216 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 173..215; lc: 66..93; URF exp: RNA data from ZMBH, RNA-expressed; MP492 complement(610459..611109)
MPN345 412681..413301 hsdR g1674183 H91_orf206 conf,Type I Restriction Enzyme (fragment)             MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 104-299 MP491 complement(608894..609514)
MPN346 413431..413778 H91_orf115 g1674182 H91_orf115 new, Type I Restriction Enzyme hsdR (fragment)             new; MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 339-434; sub: type I restriction system; fragment of subunit R of the type I restriction system exp: RNA data from ZMBH, no expression, still hypothetical; MP490 complement(608417..608764)
MPN347 413985..415115 hsdR g1674181 H91_orf376 conf,Type I Restriction Enzyme (fragment)         MPN398 cc: 152..184; lc: 279..291; MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 513-757; sub: type I restriction system; fragment of subunit R of the type I restriction system MP489 complement(607080..608210)
MPN348 416070..416564 H91_orf164 g1674179 H91_orf164 conf, 5-formyl tetrahydrofolate cyclo-ligase (HI0858) homolog; similar to GenBank Accession Number D64160, from H. influenzae     Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; 5-formyl tetrahydrofolate cyclo-ligase; ATP + 5-formyltetrahydrofolate = ADP + P + 5,10-methenyltetrahydrofolate MG245     exp: RNA data from ZMBH, no expression, still hypothetical; MP488 complement(605631..606125)
MPN349 416554..417399 H91_orf281 g1674178 H91_orf281 conserved hypothetical       MG246     conserved family of bacterial hypothetical proteins exp: RNA data from ZMBH, RNA-expressed; suggestion STRING-server: Nucleotidase MP487 complement(604796..605641)
MPN350 complement(417391..418110) ygiH g1674177 H91_orf239 conserved hypothetical transmembrane (3?)     MG247 MPN579 sp: 1..22; tm: 68..88 99..119 136..156 159..179 199..219; Conserved family of hypothetical proteins; Alignment shows 4 blocks of conservation separated by 3 hydrophobic (TM?) regions; Koonin says permease for MG homolog, I cannot see it; interesting ECOLI hypothetical prot homolog YGIH_ECOLI 205 aa and HI exp: RNA data from ZMBH, RNA-expressed; MP486 604085..604804
MPN351 complement(418116..418757) H91_orf213 g1674176 H91_orf213 new_conf, methyltransferase 10-53 matches to methyltransferase profile; rest no matches to functionally characterized proteins     MG248     new_conf (Koonin); Closer is RRMA_ECOLI 98101475 J. BACTERIOL. 180:359-365(1998); psi-blast with 73-126 of RRMA_ECOLI hits MP485, inclusion of MP485 (Y248_MYCPN) in profile brings methyltranferases in; exp RRMA_ECOLI 98101475 MP485 603438..604079
MPN352 complement(418741..420240) sigA g1674175 H91_orf499 less, Sigma-70 Factor Family 1-240 No homolog appart of MG; 240-480 Sigma-70 Factor Family 1SIG degraded by FtsH (?) MG249   lc: 127..141; less original annotation could be overprediction; exp RPSA_BACSU (371 aa) J. BIOL. CHEM. 260:7178-7185(1985); Pfam:sigma70 246-480; sub: RNA polymerase MP484 601955..603454
MPN353 complement(420293..422155) dnaE g1674174 H91_orf620 conf, DNA primase last 100 aa no homology appart of MG     MG250 MPN014 lc: 437..453; Pfam:tRNA-synt_2b 58-430 MP483 600040..601902
MPN354 complement(422139..423488) grs1 g1674173 H91_orf449 conf, glycyl-tRNA synthetase   1ATI-A   MG251 MPN553   ok MP482 598707..600056
MPN355 complement(423510..424238) yacO g1674172 H91_orf242a more_, tRNA/rRNA methyltransferase (fragment?) 1-90 Has no homologs appart from MG; 90-242 tRNA/rRNA methyltransferase     MG252 MPN521   more_ tRNA/rRNA methyltransferases; Pfam:SpoU_methylase 95-238; large family of uncharacterized proteins except one: PT56_YEAST (421 aa); This one is matched only partially (MP481 has 242 aa) 89-237 to 235-405.; exp PT56_YEAST 86093663 NUCLEIC ACIDS RES. 13:8587-8601(1985) exp: RNA data from ZMBH, no expression, still hypothetical; MP481 597957..598685
MPN356 complement(424241..425554) cysS g1674171 H91_orf437 conf, cysteinyl-tRNA synthetase   1GLN   MG253   lc: 70..80 346..356; ok MP480 596641..597954
MPN357 complement(425535..427511) lig g1674170 H91_orf658 conf, DNA ligase       MG254     conf,exp: RNA data from ZMBH, no expression, is hypothetical; (clear case for repeating expression measurements under a stress condition) MP479 594684..596660
Gly-tRNA(GGC) complement(427575..427647) mptgg     Is mptgg correct? See Trp-tRNA(TGG) above.               complement(427575..427647) 594548..594620
MPN358 427679..429283 H91_orf534 g1674169 H91_orf534 conserved hypothetical       MG255; MG255.1   tm: 182..202; lc: 104..123 150..162; conf,exp: RNA data from ZMBH, RNA-expressed; MP478 complement(592912..594516)
Trp-tRNA(TGG) 429432..429505 mptgg     Is mptgg correct? See Gly-tRNA(GGC) below.               429432..429505 complement(592690..592763)
MPN359 429513..430289 H91_orf258 g1674168 H91_orf258 conserved hypothetical       MG256   tm: 41..61 72..92; only MG and MP exp: RNA data from ZMBH, RNA-expressed; MP477 complement(591906..592682)
MPN360 430334..430627 rpmE g1674167 H91_orf97 conf, ribosomal protein L31       MG257     SUB; sub: ribosomal MP476 complement(591568..591861)
MPN361 430628..431707 prfA g1674166 H91_orf359V conf, peptide chain release factor 1       MG258   cc: 59..102; ok MP475 complement(590488..591567)
MPN362 431707..433068 H91_orf453 g1674165 H91_orf453 new, hemk family, similar to methyltransferase (S-adenosyl-methionine dependent) 66-254 similar to N-6 Adenine-specific DNA methylase 1AQI-A intermediay metabolism; methyltransferase (perhaps for adenine ?) MG259   lc: 140..155; N-terminal half (till aa 217) domain (I checked that the low cplx region inbetween is contained) is clear member of the hemK family (psi-blast, directly, e-11, many members) protoporphyrinogen oxidase is not confirmed biochemically. This is a protein of the hemK family, but new biochemical data show now clearly no (!) involvment in porphyrine synthesis, instead by sequence similarity S-adenosyl-methionine-dependent methyltransferase suggested. PMID: 10220893, UI: 99237242. N-6 adenine specific DNA methyltransferase is both similar in sequence and structure. The C-terminus is conserved hypothetical (MG,MP, Thermotoga maritima; converged) exp: RNA data from ZMBH, only once 32 degrees, low; MP474 complement(589127..590488)
MPN363 433200..433508 H91_orf102 g1674164 H91_orf102 see: MP631 conserved hypothetical         MPN152, MPN146, MPN097, MPN506, MPN408, MPN336, MPN288, MPN284, MPN281, MPN200, MPN199 sp: 1..27; see comments to MP631. MP473 complement(588687..588995)
MPN364 433547..435580 H91_orf677 g1674163 H91_orf677 see: MP631 conserved hypothetical         MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 lc: 110..137 361..389; see comments to MP631. MP472 complement(586615..588648)
MPN365 435924..436730 H91_orf268 g1674161 H91_orf268 conf,see: MP335         MPN089, MPN615, MPN507, MPN343, MPN290, MPN289, MPN285, MPN201   family, see main representative MP335 MP471 complement(585465..586271)
MPN366 436814..437632 H91_orf272 g1674160 H91_orf272 new_conf, see: MP012 involved in cytadherence         MPN149, MPN142, MPN503 lc: 43..58 72..88 222..237; exp: RNA data from ZMBH, RNA-expressed; MP470 complement(584563..585381)
MPN367 437563..438531 H91_orf322 g1674159 H91_orf322 new_conf, see: MP012 involved in cytadherence         MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN464, MPN414 lc: 3..30 244..257; exp: RNA data from ZMBH, RNA-expressed; MP469 complement(583664..584632)
MPN368 439220..439762 H91_orf180 g1674158 H91_orf180 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 69..122; URF exp: RNA data from ZMBH, RNA-expressed; MP468 complement(582433..582975)
MPN369 complement(439894..440655) H91_orf253 g1674157 H91_orf253 see: MP199, conserved hypothetical         MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN271 sp: 1..31;   MP467 581540..582301
MPN370 441296..443509 A19_orf737V g1674156 A19_orf737V conf, see: MP013         MPN144, MPN141, MPN132, MPN131, MPN101, MPN099, MPN502, MPN500, MPN468, MPN409, MPN286, MPN205, MPN202 sp: 1..20; tm: 590..610; lc: 59..76 93..105 146..163 421..435 461..474 536..548;   MP466 complement(578686..580899)
MPN371 complement(443552..444187) A19_orf211 g1674155 A19_orf211 hypothetical           lc: 122..135; URF exp: RNA data from ZMBH, RNA-expressed; MP465 578008..578643

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN372 444341..446116 A19_orf591 g1674154 A19_orf591 new, similarity to pertussis toxin subunit s1 1-240 similar to pertussis toxin subunit s1 (270 aa) 1BCP-A         new; no pfam; sub: pertussis toxin MP464 complement(576079..577854)
MPN373 complement(446127..446741) A19_orf204 g1674153 A19_orf204 hypothetical see: MP460         MPN376 lc: 158..176; similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed; MP463 575454..576068
MPN374 complement(447770..448459) A19_orf229V g1674151 A19_orf229V hypothetical see: MP460         MPN376 cc: 73..106; similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed; MP462 573736..574425
MPN375 complement(448805..449194) A19_orf129 g1674150 A19_orf129 hypothetical see: MP460         MPN376   similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed; MP461 573001..573390
MPN376 complement(449573..452995) A19_orf1140 g1674149 A19_orf1140 hypothetical         MPN375, MPN374, MPN373 sp: 1..26; lc: 272..284; No homology out of MP; MP461, MP462 and MP463 are similar to consecutive parts of this one; URF exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH TX-UF, Ges. auf Gel bei ca. 12kD (N-term.) Gel 157 bei ca. 31kD in bas. Rand; MP460 569200..572622
Arg-tRNA(CGA) complement(453260..453334) mptga                     complement(453260..453334) 568861..568935
MPN377 453422..453646   A19_orf74 A19_orf74 hypothetical               MPN377 complement(568549..568773)
MPN378 453650..456268 dnaE g1674148 A19_orf872 conf, DNA polymerase III alpha subunit 1-100 DP3A_ECOLI PSI-BLAST iter-3 Identities = 29/101 (28%) J. Bacteriol. 169 (12), 5735-5744 (1987); 100-260 exclusive of DP3A_MYCPN DP3A_MYCGE; 260-780 DP3A_ECOLI FASTA 34.7% identities, length = 574; 780-872 unique of DP3A_MYCPN DP3A_MYCGE     MG261 MPN034 lc: 157..163; story It has a different domain organization than other DP3As; No PFAM; Note the different domain organization; exp DP3A_ECOLI 88058791; DP3A_ECOLI has domains not present in this one!; sub: DNA polimerase III MP459 complement(565927..568545)
MPN379 456272..457147 polA g1674147 A19_orf291 less, 5'-3' exonuclease (complete)   1BGX-T   MG262 MPN658   less It is not a fragment of a DNA polymerase I but a complete 5'-3' exonuclease; PF01367 5_3_exonuclease; exp EX9_ECOLI 98256427 NUCLEIC ACIDS RES. 26:2593-2597(1998) 26.2% identities, length = 221 SwissProt annot CONF,but gene name still polA exp: RNA data from ZMBH only once at 32 degrees, doubtful; MP458 complement(565048..565923)
MPN380 457147..457980 fpg g1674146 A19_orf277 conf, formamidopyrimidine-DNA glycosylase       MG262.1     PF01149 Formamidopyrimidine-DNA glycosylase; exp FPG_LACLC 37.1% identities, length = 275 MICROBIOLOGY 141:411-417(1995) MP457 complement(564215..565048)
MPN381 458126..459004 yidA g1674144 A19_orf292 new_conf, HAD superfamily hydrolase/phosphatase       MG263 MPN383   new_conf Koonin; PFAM DUF3 exp: RNA data from ZMBH, RNA-expressed; MP456 complement(563191..564069)
MPN382 458998..459600 A19_orf200 g1674143 A19_orf200 conserved hypothetical       MG264     hypothetical family; Pfam:UPF0038 exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP455 complement(562595..563197)
MPN383 complement(459530..460378) yidA g1674142 A19_orf282 new_conf, HAD superfamily hydrolase/phosphatase       MG265 MPN427, MPN381, MPN264   new_conf Koonin; alignment PFAM DUF3 bacterial domain of unknown function exp: RNA data from ZMBH, RNA-expressed; MP454 561817..562665
MPN384 complement(460381..462762) leuS g1674141 F11_orf793o conf, leucyl-tRNA synthetase       MG266 MPN023, MPN520, MPN480     MP453 559433..561814
MPN385 complement(462763..463107) F11_orf114 g1674140 F11_orf114 conserved hypothetical       MG267   sp: 1..19; tm: 76..96; MP MG specific exp: RNA data from ZMBH, RNA-expressed; MP452 559088..559432
MPN386 complement(463142..463831) yaaF g1674139 F11_orf229 more__, DEOXYGUANOSINE KINASE/ DEOXYADENOSINE KINASE   1UKY   MG268   lc: 47..60; new_add: 2.7.1.113. The molecular function on the left is more specific than Sternberg nucleotide kinase and than genebankMG cons hyp exp: RNA data from ZMBH, RNA-expressed; MP451 558364..559053
4.5S_RNA complement(463876..463954) No info     S76009 has more 5'-34 and 3'-21 residues comparing to ZMBH www page, but scRNA corresponds to 35-113 of S76009. Then the length is the same as ZMBH. There is one mismatch between the selected region in the genome sequence and S76009.               complement(463876..463954) 558241..558319
MPN387 complement(463979..465055) F11_orf358b g1674138 F11_orf358b conserved hypothetical       MG269 MPN399, MPN310 cc: 87..273; coiled coil exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, TX-UF, Ges. MP450 557140..558216
MPN388 complement(465048..465434)   New identified New identified conserved hypothetical               449-450 557019..557147
MPN389 complement(465427..466446) lplA g1674137 F11_orf339 conf, lipoate protein ligase       MG270       MP449 555749..556768
MPN390 complement(466473..467846) pdhD g1674136 F11_orf457 conf, dihydrolipoamide dehydrogenase   1LPF-A Energy metabolism, Pyruvate dehydrogenase; dihydrolipoamide dehydrogenase (pdhD); Dihydrolipoamide + NAD(+) = lipoamide + NADH ; MG271 MPN051, MPN557, MPN394, MPN240 lc: 86..98 175..184; dihydrolipoamide dehydrogenase MP448 554349..555722
MPN391 complement(467847..469055) pdhC g1674135 F11_orf402 conf, dihydrolipoamide acetyltransferase component (E2)   1E2O, 1IYU Energy metabolism, Pyruvate dehydrogenase; dihydrolipoamide acetyltransferase component (E2); Acetyl-CoA + dihydrolipoamide = CoA + S-acetyldihydrolipoamide; MG272 MPN119, MPN452 lc: 80..118 138..170; dihydrolipoamide acetyltransferase component (E2) MP447 553140..554348
MP200_RNA complement(469102..469312)                       complement(469102..469312) 552883..553093
MPN392 complement(469374..470357) pdhB g1674134 F11_orf327 conf, pyruvate dehydrogenase E1-beta subunit   1AY0-A Energy metabolism, Pyruvate dehydrogenase; pyruvate dehydrogenase E1-beta subunit (pdhB); pyruvate + lipoamide = S-acetyldihydrolipoamide + CO2 (with the alpha subunit only) MG273   lc: 61..77; E1-beta subunit sub MP446 551838..552821
MPN393 complement(470379..471455) pdhA g1674133 F11_orf358a conf, Pyruvate dehydrogenase   1AY0-A Energy metabolism, Pyruvate dehydrogenase; pyruvate dehydrogenase E1-alpha subunit (pdhA); pyruvate + lipoamide = S-acetyldihydrolipoamide + CO2; (with the beta subunit only note: no accident, the NADH oxidase MP444 so close to the pyruvate dehydrogenase; sense/ story ? MG274 MPN082   E1-alpha subunit sub MP445 550740..551816
MPN394 complement(471476..472915) nox g1674132 F11_orf479 conf, NADH oxidase   1BHY Energy metabolism, Aerobic; NADH oxidase (nox); NADH + H(2)O(2) = NAD + 2 H2O ; hemolysin; pathogenicity factor; MG275 MPN390     MP444 549280..550719
MPN395 complement(472983..473516) apt g1674131 F11_orf133 conf, adenine phosphoribosyltransferase   1A3C Nucleotide and deoxynucleotide degradation or rescue reaction. adenine phosphoribosyltransferase; AMP + pyrrophosphate = Adenine + phosphoribosylpyrrophosphate. MG276 MPN073   extend gene to 5' GTG start conf,Mikita found this N-terminal extension, so in fact MKQKLQALDRAIKRFNDFPTPGILFYDITPIFLNSELFEFVLEQ before MAQFIQEVKADGIVCP..., but Bairoch (P75388) not; Richard Hermann SEES this N-terminal extension also in his gels. MP443 548811..549212
MPN396 complement(473551..476466) F11_orf887 g1674129 F11_orf887 new, protein export, secD like       MG277   tm: 432..452 462..482 485..505 534..554 572..592 641..661 678..698 706..726 735..755 793..813 817..837; lc: 66..80 292..307; secD-like domain in the protein; homologous in psi-blast to B.subtilis secDF (fusion); however, further analysis shows that the secD domain of B.subtilis finds MP442 back in psi-blast significantly (2nd iteration, e-37) and that these are definitely at least secD-like domains. Confirming evidence is available from the strings neighbourhood server (note that there is one big family with secD and F fused in addition to understand better strings server output). Detailed sequence alignment shows clear homology to secD family, but again that the domain is only secD-like. MP442 545981..548644
MPN397 476470..478671 spoT g1674128 F11_orf733 more__, p)ppGpp 3'-pyrophosphohydrolase     regulatory function MG278   cc: 508..530; lc: 489..501; story: produces ppGpp, mediator for stringent response which binds to the beta subunit of the RNA polymerase (MP236) inhibiting transcription, and in E. coli (98190325) activates the PHO regulon related to phosphate transport - It could do the same in MP with operon MP231-234 MP441 complement(543524..545725)
MPN398 complement(478668..479324) F11_orf218 g1674127 F11_orf218 conserved hypothetical       MG279   sp: 1..26; tm: 160..180; exp: RNA data from ZMBH, RNA-expressed; MP440 542871..543527

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN399 complement(479324..480187) F11_orf287 g1674126 F11_orf287 conserved hypothetical       MG280 MPN387 sp: 1..30; tm: 226..246; cc: 68..144; exp: RNA data from ZMBH, RNA-expressed; MP439 542008..542871
MPN400 complement(480249..481997) F11_orf582 g1674125 F11_orf582 conserved hypothetical       MG281   lc: 6..18; exp: RNA data from ZMBH, RNA-expressed; MP438 540198..541946
Gly-tRNA(GGA) complement(482285..482358)       In Genbank, "gene" missing. Maybe gene = "mptrna"               complement(482285..482358) 539837..539910
Leu-tRNA(TTA) complement(482365..482450) mptrna                     complement(482365..482450) 539745..539830
Lys-tRNA(AAA) complement(482451..482525) mptrna                     complement(482451..482525) 539670..539744
Gln-tRNA(CAA) complement(482569..482643) mptrna                     complement(482569..482643) 539552..539626
Tyr-tRNA(TAC) complement(482649..482735) mptrna                     complement(482649..482735) 539460..539546
MPN401 complement(482765..483247) greA g1674124 F11_orf160 conf, transcription elongation factor   1GRJ   MG282       MP437 538948..539430
MPN402 483529..484980 proS g1674123 F11_orf483 conf, putative prolyl-tRNA synthetase; similar to Swiss-Prot Accession Number P38708, from S. cerevisiae   1ATI-A   MG283   lc: 403..415;   MP436 complement(537215..538666)
MPN403 485125..485493 F11_orf122a g1674121 F11_orf122a conserved hypothetical       MG284     exp: RNA data from ZMBH, RNA-expressed; MP435 complement(536702..537070)
MPN404 485474..486514 F11_orf346 g1674120 F11_orf346 conserved hypothetical       MG285   lc: 219..228; MG MP specific exp: RNA data from ZMBH, RNA-expressed; MP434 complement(535681..536721)
MPN405 486521..487114 F11_orf197 g1674119 F11_orf197 conserved hypothetical       MG286   sp: 1..26; MG MP specific exp: RNA data from ZMBH, RNA-expressed; MP433 complement(535081..535674)
MPN406 487149..487403 F11_orf84 g1674118 F11_orf84 conf, acyl carrier protein homolog; similar to GenBank Accession Number L43074_3, from S. glaucescens     Fatty acid and phospholipid metabolism; acyl carrier protein; MG287       MP432 complement(534792..535046)
Trp-tRNA(TGA) 487394..487468 mptgwa                     487394..487468 complement(534727..534801)
MPN407 complement(487508..490147) F11_orf879 g1674117 F11_orf879 new, lipase Lipase_GDSL: 540-624         sp: 1..36; exported, Lipase_GDSL domain (PFAM 1.5 E-3 score for a Lipase GDSL domain) , new MP431 532048..534687
MPN408 490375..492657 F11_orf760 g1674116 F11_orf760 see: MP631, conserved hypothetical         MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 sp: 1..28; see comments to MP631. exp: 2D-Gel data from ZMBH, TX-UF, auf Gel mw ca. 25kD, IEP 6.7; MP430 complement(529538..531820)
MPN409 492730..494331 F11_orf533L g1674115 F11_orf533L conf, see: MP013         MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN370, MPN286, MPN203, MPN202 lc: 28..45 66..76 111..127 390..402 425..437 452..463;   MP429 complement(527864..529465)
MPN410 494694..495140 F11_orf148o g1674114 F11_orf148o hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204   URF exp: RNA data from ZMBH, RNA-expressed; MP428 complement(527055..527501)
MPN411 complement(495282..496040) A05_orf252 g1674113 A05_orf252 see: MP199; conserved hypothetical         MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN369, MPN271 sp: 1..31;   MP427 526155..526913
MPN412 496634..497470   A05_orf278 A05_orf278 not in Genbank, but in the ZMBH list               426.2 complement(524725..525561)
MPN413 497547..497966   A05_orf139 A05_orf139 not in Genbank, but in the ZMBH list               426.1 complement(524229..524648)
MPN414 498076..499557 A05_orf493 g1674111 A05_orf493 see: MP012, new_conf, involved in cytadherence         MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN468, MPN464, MPN367 lc: 44..61 252..265; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP426 complement(522638..524119)
MPN415 499808..500950 P37 g1674110 A05_orf380V conf, high affinity transport system protein P37     Transporter, ABC superfamily; function ? MG289   sp: 1..30;   MP425 complement(521245..522387)
MPN416 500943..501677 P29 g1674109 A05_orf244 conf, ATP-binding protein P29     Transporter, ABC superfamily; function ? MG290 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193     MP424 complement(520518..521252)
MPN417 501670..503298 P69 g1674108 A05_orf542 conf, transport system permease protein P69     Transporter, ABC superfamily; function ? MG291   sp: 1..42; tm: 76..96 113..133 137..157 208..228 234..254 286..306 351..371 410..430 509..529; lc: 373..394 484..500;   MP423 complement(518897..520525)
MPN418 complement(503299..503721)   New identified New identified conserved hypothetical               422-423 518474..518896
MPN419 complement(503721..506423) alaS g1674107 A05_orf900 conf, alanyl-tRNA synthetase       MG292   lc: 313..331 616..632 872..886;   MP422 515772..518474
MPN420 complement(506475..507200) glpQ g1674106 A05_orf241a conf, glycerophosphoryl diester phosphodiesterase     Central intermediary metabolism; Other; glycerophosphoryl diester phosphodiesterase (glpQ); glycerophosphodiester + H2O = an alcohol + sn-glycerol 3-phosphate; MG293 MPN566     MP421 514995..515720
MPN421 complement(507193..508620) A05_orf475 g1674105 A05_orf475 conf, permease     Transporter, MFS type; MG294 MPN113, MPN112 tm: 18..38 58..78 88..108 121..141 165..185 201..221 253..273 277..297 319..339 350..370 434..454; annotated already for MG MP420 513575..515002
MPN422 complement(508751..509863) A05_orf370 g1674103 A05_orf370 new_conf, TRNA (5-METHYLAMINOMETHYL-2-THIOURIDYLATE)-METHYLTRANSFERASE.   1GPM-A   MG295 MPN562   new_conf: Is not in genebank, also not in genbankMG (cons hyp); N-type pyrrophosphatase by Sternberg, but as tRNA methyltransferase in Swissprot; exp: RNA data from ZMBH, 32 degrees, RNA-expressed MP419 512332..513444

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN423 complement(509864..510253) A05_orf129 g1674102 A05_orf129 conserved hypothetical       MG296     exp: RNA data from ZMBH, RNA-expressed; MP418 511942..512331
MPN424 complement(510253..510561) ylxM g1674101 A05_orf102 conserved hypothetical           lc: 72..85; DNA binding ? conserved gene order vs. B.subtilis MP416-MP417 BS1595-1597 exp: RNA data from ZMBH, no expression, is hypothetical ! MP417 511634..511942
MPN425 complement(510542..511588) ftsY g1674100 A05_orf348 conf, cell division protein FtsY   1FTS   MG297 MPN061     MP416 510607..511653
MPN426 complement(511594..514542) A05_orf982 g1674099A A05_orf982 new, SMC family, chromosome/DNA binding/protecting functions       MG298   cc: 171..226 263..319 567..646 782..817; less: P115 is a misleading descriptor (there is a golgi associated - eukaryotic - P115 protein); smc family is present in archaea bacteria and eukarya; exp: _SUBTI 98417635; Structural maintenance of chromosomes (SMC) proteins function in chromosome condensation and several other aspects of DNA processing.They are large proteins characterized by an NH2-terminal nucleotide triphosphate (NTP)-binding domain, two long segments of coiled coil separated by a hinge, and a COOH-terminal domain. In UI91138990 / JQ0894 the authors desribe only the ATP/GTP binding motif and exp cytoplasmic localization MP415 507653..510601
MPN427 514727..515599 yidA g1674098 A05_orf290 new, hydrolase/phosphatase DUF3 (PFAM)       MPN383, MPN264   new exp: RNA data from ZMBH, RNA-expressed; MP414 complement(506596..507468)
MPN428 complement(515605..516567) pta g1674097 A05_orf320 conf, phosphotransacetylase     Central intermediary metabolism, Other; phosphotransacetylase (pta); note: [Phosphate acetyltransferase Phosphoacylase] also acts with other short-chain acyl-CoA's. AcetylCoA + P = CoA + acetyl-phosphate; MG299     MP411, 412, 413 linking glycolysis to anaerobic acetate production MP413 505628..506590
MPN429 complement(516605..517834) pgk g1674096 A05_orf409 conf, phosphoglycerate kinase   1PHP Energy metabolism, Glycolysis; phosphoglycerate kinase (pgk); 3-phospho-D-glycerate + ATP = ADP + 3-phospho-D-glyceroyl phosphate; MG300 MPN026     MP412 504361..505590
MPN430 complement(517837..518850) gap g1674095 A05_orf337 conf, glycerladehyde-3-phosphate dehydrogenase   1GAD-O Energy metabolism, Glycolysis; glyceraldehyde-3-phosphate dehydrogenase(gap); D-glyceraldehyde 3-phosphate + phosphate + NAD(+)= 3-phospho-D-glyceroyl phosphate + NADH; MG301       MP411 503345..504358
MPN431 complement(518881..519834) A05_orf317 g1674094 A05_orf317 new_conf, permease     Transporter, ABC superfamily; subunit of unknown transporter, perhaps involved in cobalt or cobolamin transport; MG302 MPN195 sp: 1..34; tm: 53..73 124..144 253..273; new_conf; J. Bacteriol. 175 (11), 3303-3316 (1993) cobalt ? cobalt permease and related tranpsorters also by COG619 MP410 502361..503314
MPN432 complement(519824..520972) artP g1674093 A05_orf382 conf, abc transport ATP-binding protein     Transporter, ABC superfamily; subunit of unknown transporter, perhaps involved in cobalt or cobolamin transport; MG303 MPN134, MPN081, MPN055, MPN685, MPN683, MPN609, MPN433, MPN416, MPN258, MPN218, MPN217, MPN194, MPN193 lc: 278..290; cobalt ? Mikita sees an overlap with MP408 of 106 bp.s; Bairoch has the start (P75356) at MQTPQIIWSLIAPQYRGLAN ... so 29 AA shorter (but not 35 Aa), which reduces the overlap; MP409 501223..502371
MPN433 complement(520867..521679) cbiO g1674092 A05_orf270L conf, abc transport ATP-binding protein     Transporter, ABC superfamily; subunit of unknown transporter, perhaps involved in cobalt or cobolamin transport; MG304 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN432, MPN416, MPN334, MPN258, MPN218, MPN194, MPN193   cobalt ? MP408 500516..501328
MPN434 complement(521837..523624) dnaK g1674090 A05_orf595 conf, dnaK   1ATR, 1DKX-A Chaperon; activated by DnaJ MG305   cc: 230..261 499..518; sub:hsp70 with dnaJ (MP133) and grpE (MP034) MP407 498571..500358
MPN435 complement(523680..524867) A05_orf395 g1674089 A05_orf395 new, permease       MG306   sp: 1..42; tm: 56..76 92..112 139..159 176..196 254..274 345..365; new, by sequence similarity; cons hyp by Sternberg and GenbankMG;swissprot and COG392 say just integral membrane protein; MP406 497328..498515
MPN436 complement(524877..528611) A05_orf1244 g1674088 A05_orf1244 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium       MG307 MPN489, MPN485, MPN444, MPN442, MPN440, MPN439, MPN438, MPN437 sp: 1..34; lc: 441..453 478..491 548..564; see also MP 353, this is clearly a Mollicute specific lipoprotein MP405 493584..497318
MPN437 complement(528920..530638) H08_orf572o g1674087 H08_orf572o see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium         MPN489, MPN444, MPN440, MPN436 lc: 192..208 364..376;   MP404 491557..493275
MPN438 complement(530856..531893) H08_orf345 g1674086 H08_orf345 see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium         MPN440, MPN436 lc: 28..48 236..251 299..332;   MP403 490302..491339
MPN439 complement(531949..532662) H08_orf237 g1674085 H08_orf237 see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium         MPN489, MPN444, MPN442, MPN436 sp: 1..29;   MP402 489533..490246
MPN440 complement(532818..534998) H08_orf726 g1674084 H08_orf726 see: MP405 more__, Mollicute specific lipoprotein, MG307 homolog, from M. genitalium         MPN489, MPN444, MPN438, MPN437, MPN436 lc: 39..50 329..342 373..387 501..514 667..678;   MP401 487197..489377
MPN441 535468..535776 H08_orf102 g1674083 H08_orf102 conserved hypothetical           tm: 52..72; exp: RNA data from ZMBH, once at 32 degree, doubtful; MP400 complement(486419..486727)
MPN442 complement(536089..536541) H08_orf150 g1674081 H08_orf150 more__, species specific lipoprotein         MPN444, MPN439, MPN436 sp: 1..29; new_add (see MP353) MP399 485654..486106
MPN443 complement(536526..537755) deaD g1674080 H08_orf409 conf, RNA helicase, eIF4-A translation initiation factor   1A1V-A   MG308 MPN623, MPN211     MP398 484440..485669
MPN444 complement(537762..541739) H08_orf1325 g1674079 H08_orf1325 conserved hypothetical       MG309 MPN489, MPN485, MPN442, MPN440, MPN439, MPN437, MPN436, MPN333 sp: 1..29; cc: 691..719; lc: 436..465 918..932 993..1014 1273..1285; Avian Dis. 35 (1), 62-69 (1991) exp: RNA data from ZMBH, RNA-expressed; MP397 480456..484433
MPN445 541734..542603 lip3 g1674078 H08_orf289 conf, triacylglycerol lipase (lip) 3   1BE0 Fatty acid and phospholipid metabolism; triacylglycerol lipase; Triacylglycerol + H2O = diacylglycerol + a fatty acid anion. MG310 MPN519, MPN473   Gene 158 (1), 107-111 (1995); Mikita sees good intergenic region; Bairoch: Real start at MRLEIENGLEFVCDPFLNE... the fist 20 aa are not real. MP396 complement(479592..480461)
MPN446 complement(542664..543281) rpsD g1674077 H08_orf205 conf, ribosomal protein S4       MG311   SUB ribosomal SUB; putative HMW cytadherence operon (promotor localization and terminator sequences, lack of Shine-Dalgarno sequences in most of the ORFs in this putative operon; Krause,D. Mol.Microbiology 1996; 20, 247-253. MP395 478914..479531
MPN447 complement(543304..546360) hmw1 g1674076 H08_orf1018 conf, cytadherence accessory protein HMW1 105-140 domain present in MP035 and MP275     MG312 MPN119, MPN687, MPN567, MPN474, MPN452, MPN154 cc: 782..816 849..879; lc: 211..229 331..344 347..363 391..415 426..466 468..482 553..569; story: contains a domain, exclusive to MP/MG, common to another cytadherence protein and to a protein with probable cochaperone activity putative HMW cytadherence operon; HMW1; MP394 475835..478891
MPN448 complement(546424..547281) H08_orf263 g1674075 H08_orf263 conserved hypothetical       MG313   sp: 1..43; tm: 56..76 96..116 138..158 175..195; exp: RNA data from ZMBH, RNA-expressed; putative HMW cytadherence operon; P33 MP393 474980..475771
MPN449 complement(547332..548678) orf8 g1674073 H08_orf448 conserved hypothetical       MG314   tm: 202..222 267..287 328..348 386..406; putative HMW cytadherence operon; P50; MP392 473517..474863
MPN450 complement(548690..549634) orf7 g1674072 H08_orf314 conserved hypothetical       MG315   sp: 1..21; lc: 229..241; exp: RNA data from ZMBH, RNA-expressed; putative HMW cytadherence operon; P36; MP391 472561..473505
MPN451 complement(549513..550622) come3 g1674071 H08_orf369 conf, competence locus operon protein 3 homolog; similar to Swiss-Prot Accession Number P39695, from B. subtilis       MG316   sp: 1..19; tm: 25..45 48..68 120..140 152..172 207..227 235..255 268..288 323..343; J. Bacteriol. 180 (10), 2701-2710 (1998) putative HMW cytadherence operon (ref. see MP395); P43 MP390 471573..472682
MPN452 complement(550662..552680) hmw3 g1674070 H08_orf672 conf, cytadherence accessory protein HMW3       MG317 MPN618, MPN567, MPN447, MPN391, MPN309, MPN157, MPN154 lc: 219..244 283..299 304..346 381..465 615..630; Infect. Immun. 60 (4), 1633-1641 (1992) putative HMW cytadherence operon (ref. see MP395) MP389 469515..471533

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN453 complement(552694..553518) H08_orf274 g1674069 H08_orf274 conf, 30K adhesin-related protein       MG318   sp: 1..28; tm: 77..97; cc: 99..148; lc: 149..164 172..272; J Bacteriol 1995Oct;177(20):5943-51 putative HMW cytadherence operon (ref. see MP395); P30; MP388 468677..469501
MPN454 complement(553539..554120) H08_orf193 g1674068 H08_orf193 conserved hypothetical       MG319   sp: 1..35; tm: 136..156; lc: 57..85 159..174; putative HMW cytadherence operon (ref. see MP395); P21; MP387 468075..468656
MPN455 complement(554209..555072) ctaD g1674067 H08_orf287 conserved hypothetical       MG320   sp: 1..47; tm: 66..86 104..124 135..155 171..191 207..227 254..274; old_gb exp: RNA data from ZMBH, RNA-expressed; MP386 467123..467986
Ser-tRNA(TCC) 555141..555232 mptgs                     555141..555232 complement(466963..467054)
Ser-tRNA(TCG) 555234..555322 mptgs                     555234..555322 complement(466873..466961)
MPN456 complement(555398..558415) H08_orf1005 g1674066 H08_orf1005 conserved hypothetical       MG321 MPN459, MPN458, MPN457 sp: 1..19; lc: 110..131 604..637; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP385 463780..466797
MPN457 complement(558798..559787) H08_orf329V g1674064 H08_orf329V hypothetical see: MP385         MPN456 lc: 116..131 176..187; old_gb exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP384 462408..463397
MPN458 complement(559729..560202) H08_orf157b g1674063 H08_orf157b conserved hypothetical,see: MP385         MPN456 lc: 70..84;   MP383 461993..462466
MPN459 complement(560123..561898) H08_orf591 g1674062 H08_orf591 conserved hypothetical, see: MP385         MPN456 sp: 1..49; lc: 130..153;   MP382 460297..462072
Leu-tRNA(CTA) complement(562058..562142) mptgv                     complement(562058..562142) 460053..460137
Lys-tRNA(AAG) complement(562147..562222) mptgv                     complement(562147..562222) 459973..460048
Thr-tRNA(ACA) complement(562235..562310) mptgv                     complement(562235..562310) 459885..459960
Val-tRNA(GTA) complement(562312..562387) mptgv                     complement(562312..562387) 459808..459883
Thr-tRNA(ACG) complement(562395..562469) mptgv                     complement(562395..562469) 459726..459800
Glu-tRNA(GAA) complement(562471..562547) mptgv     in Genbank, /product="tRNA-Gln" is wrong.               complement(562471..562547) 459648..459724
Asn-tRNA(AAC) complement(562556..562630) mptgv                     complement(562556..562630) 459565..459639
MPN460 complement(562658..564355) ntpJ g1674061 H08_orf565 more_, ktrB     Transporter, trk family; Na+ translocating, probably H+ or K+ antiporter; partner protein MP380; for ion maintenance of H,Na,K; perhaps Ca++ ? MG322 MPN054 sp: 1..21; tm: 29..49 109..129 163..183 259..279 316..336 404..424 461..481 526..546; SUB, subunit, MP380 is the partner; J. Bacteriol. 180 (13), 3491-3494 (1998) MP381 457840..459537
MPN461 564390..565085 yzaC g1674060 H08_orf231 new_conf, KtrA, K+ Na+ uptake   1B3R-A Transporter, trk family; Na+ translocating, probably H+ or K+ antiporter; for ion level maintanance of all three; MG323     SUB, subunit, MP381 is the partner; J. Bacteriol. 180 (13), 3491-3494 (1998) new exp: RNA data from ZMBH, RNA-expressed; confirmed by COG569, reckognizes this also as potassium binding TrkA component; MP380 complement(457110..457805)
MPN462 565237..566049 H08_orf270 g1674059 H08_orf270 conf, see: MP013         MPN141, MPN128, MPN101, MPN502, MPN205 lc: 17..47 98..114;   MP379 complement(456146..456958)
MPN463 566124..566597 H08_orf157a g1674058 H08_orf157a conserved hypothetical         MPN115, MPN091 lc: 135..148; MP specific exp: RNA data from ZMBH, RNA-expressed; MP378 complement(455598..456071)
MPN464 566891..568228 H08_orf445 g1674057 H08_orf445 new_conf, involved in cytadherence, see: MP012         MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN414, MPN367 lc: 174..187; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP377 complement(453967..455304)
MPN465 complement(568645..569244) P01_orf199 g1674056 P01_orf199 conserved hypothetical         MPN103, MPN037 tm: 72..92 100..120 145..165; MP specific exp: RNA data from ZMBH, RNA-expressed; MP376 452951..453550
MPN466 complement(569288..569710) P01_orf140 g1674055 P01_orf140 conserved hypothetical see: MP199         MPN148, MPN012, MPN011, MPN649, MPN646, MPN641, MPN505, MPN411, MPN369, MPN271   exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP375 452485..452907
MPN467 complement(569740..570045) P01_orf101 g1674054 P01_orf101 conserved hypothetical see: MP199         MPN054, MPN012, MPN011, MPN654, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN523, MPN505, MPN411, MPN369, MPN271 sp: 1..31; less; exp: RNA data from ZMBH, RNA-expressed; MP374 452150..452455
MPN468 570782..571408 P01_orf208V g1674052 P01_orf208V conserved hypothetical see: MP013         MPN144, MPN141, MPN131, MPN500, MPN409, MPN370, MPN286, MPN202 lc: 96..111 114..132 159..173; less MP373 complement(450787..451413)
RNaseP_RNA complement(571431..571801) No info     The sequence in ZMBH www page is complementary strand. About RNaseP, see www.mbio.ncsu.edu/RNaseP. There is one-residue offset between the sequnece in RNaseP DB and ZMBH. I adopted the position of match with the sequence in RNaseP DB. There are 2 gaps and 1 mismatch between RNaseP in the Mp genome sequence and that in the RNaseP DB.               complement(571431..571801) 450394..450764
10sa_RNA 571825..572211 No info     The sequence in ZMBH www page is complementary strand. About 10sa RNA (tmRNA), see sunflower.bio.indiana.edu/~kwilliam/tmRNA/home.html.               571825..572211 complement(449984..450370)
MPN469 complement(572254..572985) P01_orf243 g1674051 P01_orf243 conserved hypothetical       MG323.1   tm: 38..58 99..119 144..164 206..226; MG-MP specific; Note 445 nts after this ORF and 109 nts before the next ORF stretches the MCS5 RNA homologue from MP (exp characterized only in M.capricolum; Matsuda et al., NAR 37,187-188 (1997); this is the RNA component of RNAse P MP372 449210..449941
MPN470 complement(573026..574090) pepX g1674050 P01_orf354 conf, X-Pro dipeptidase   1CHM-A   MG324     J Bacteriol 1998 Sep;180(18):4781-9 exp: RNA data from ZMBH, no expression, is hypothetical; (but should be expressed from the logic) MP371 448105..449169
MPN471 complement(574090..574251) rpmG g1674049 P01_orf53 conf, ribosomal protein L33       MG325     SUB; MP370 447944..448105

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN472 complement(574270..575151) degV g1674048 P01_orf293 conserved hypothetical       MG326 MPN664   broad distribution; exp: RNA data from ZMBH, RNA-expressed; MP369 447044..447925
MPN473 complement(575157..575963) lip2 g1674047 P01_orf268 conf, triacylglycerol lipase (lip) 2   1A7U-A Fatty acid and phospholipid metabolism; triacylglycerol lipase; Triacylglycerol + H2O = diacylglycerol + a fatty acid anion. MG327 MPN519, MPN445   Gene 1995 May 26;158(1):107-11 MP368 446232..447038
MPN474 complement(575950..579051) P01_orf1033 g1674046 P01_orf1033 new, coiled coil protein, putative structural protein involved in cytosceleton well coiled coil, 294-326; coil 355-654; coil 681-921 7 seg regions     MG328 MPN310 cc: 294..326 355..636 681..921; lc: 249..262 666..679 976..994; new, similarities to: GIANTIN (GOLGI COMPLEX-ASSOCI... 84 3e-15 from Rat, UI: 98093490; rat hit Q420-972 S2327-2896 myosins etc. however, Filter is there; C-term part clear homology; uso1 intracell transport protein from yeast 1e-10 Q419-974 S1094-1632 protein could with this large coil regions be really a coiled coil with sceleton; cave coiled-coil destroys all function predictions; but may be really a structural protein in this case. MP367 443144..446245
MPN475 complement(579408..580757) P01_orf292 g1674045 P01_orf292 more__, GTPase, GTP binding, see comments   121P regulatory function (?) MG329 MPN008, MPN656, MPN568, MPN481, MPN155   new_add:GTP binding / GTPase, clear big family, full length; GenebankMG says cons hyp GTP-binding protein; Sternberg says P-loop containing nucleotide triphosphate hydrolase; swissprot says era/thdf family of GTP binding proteins. exact function needs more data, could include MYZUS PERSICAE PRIMARY ENDOSYMBIONT Q24-152 S218-346 added first: GroEL-like homolog MEDLINE; 98080423. 2e-11; New_add second: N-terminal sequence extended by Mikita total length 449 in accordance to homologs; unconnected; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP366 441909..442787
MPN476 complement(580759..581412) cmk g1674043 P01_orf217 conf, cytidylate kinase   1AK2 ucleotide and deoxynucleotide degradation or rescue reaction. cytidylate kinase; NTP + cytidine = NDP + CMP. MG330     full length; exp evidence E.coli, B.sub ARCH. BIOCHEM. BIOPHYS. 340:144-153(1997)UI: 97271336; Note: Though nice primary sequence similarity EC protein alpha and coil, BS beta strands; difficult to say how the structure from MP will look MP365 440783..441436
MPN477 complement(581439..582068) P01_orf209 g1674042 P01_orf209 conserved hypothetical       MG331   tm: 186..206; cc: 19..41; lc: 133..145; exp: RNA data from ZMBH, RNA-expressed; MP364 440127..440756
MPN478 complement(582071..582778) P01_orf235 g1674041 P01_orf235 new, similar to spore coat protein       MG332   lc: 145..167; yebC family member conserved hypothetical proteins 1st iteration psi blast; 2nd psi converged; dbj BAA34259.1 (AB014075) Orf2u [Clostridium histolyticum]1e-74 and emb CAB14742 (Z99118) similar to spore coat protein [Bacillus subtilis] 1e-72 Q6-233 S9-237 new functional annotation; cons. hyp. in COG0217;exp: RNA data from ZMBH, RNA-expressed; MP363 439417..440124
MPN479 complement(582782..583375) P01_orf197 g1674040 P01_orf197 new_conf, ACYL CARRIER PROTEIN PHOSPHODIESTERASE     Fatty acid and phospholipid metabolism; [Acyl-carrier protein]+ H(2)O = 4'-phosphopantetheine + apoprotein.     tm: 150..170; ACYL CARRIER PROTEIN PHOSPHODIESTERASE "Isolation and properties of acyl carrier protein phosphodiesterase of Escherichia coli." J. BACTERIOL. 172:5445-5449(1990) UI: 90368607, exp analysis of the protein 1e-06 Q3-169 S2-175; should have some flanking activities, connnected to MP500, phosphopantetheine adenylyltransferase; new_conf COG1182; exp: RNA data from ZMBH, RNA-expressed; MP362 438820..439413
MPN480 complement(583403..585919) valS g1674039 P01_orf838 conf, valyl-tRNA synthetase SEG 368-377 seg 720-734 coil 768-734 seg 811-826     MG334 MPN023, MPN520, MPN384 cc: 768..824; clear; exp evidence N-term till res 367 3.9e-58 S.pombe, UI: 98284022. exp: RNA data from ZMBH, no expression, is hypothetical ! (and a tRNA should be expressed, always, shouldn't it ?) MP361 436276..438792
MPN481 complement(585903..586484) yihA g1674038 P01_orf193 more_ , GTP binding, era like   1AA9 regulatory function (?) MG335 MPN008, MPN656, MPN475   more_, blast: whole family; GTP binding era-family is probably right Q26-186 S 9-167 3e-4 to >sp O51604 ERA_BORBU (ERA..)GTP-BINDING PROTEIN ERA HOMOLOG.[BORRELIA BURGDORFERI] unconnected; exp:YIHA_ECOLI 98414051 shown to be essential in a knockout experiment; unconnected exp: RNA data from ZMBH, RNA-expressed; MP360 435711..436292
MPN482 complement(586492..586686)   New identified New identified conserved hypothetical               359-360 435509..435703
MPN483 586772..587797 yibD g1674037 P01_orf341 more__, bifunctional threonine dehydrogenase; galactosyltransferase     amino acid metabolism; L-threonine + NAD <-> 2-amino-3-ketobutyrate + NADH + H+ ; bifunctional: carbohydrate metabolism; sugar; sugar transferase MG335.2     more__, solid hit to EC threonine dehydrogenase (P11290; P22999 are, as noted before in genbank via swissprot), UI 89174812; Q2-245 S6-253 Score = 60.5 bits (144), Expect = 1e-08, Dekker group collected lots of exp. on the EC homologue; further clear similarity (whole family and around the EC hit) to galactosyl and other sugar transferases, e.g.MEDLINE; 98125733; broader specificity would allow both reactions,note further that the galactosyltransferase_2 domain (here 1-180AA)is found in a diverse set of enzymes; though there are here also complete length hits to such enzymes . exp: RNA data from ZMBH, RNA-expressed; MP359 complement(434398..435423)
MPN484 complement(588302..588613) P02_orf103b g1674036 P02_orf103b hypothetical, see: MP141         MPN151, MPN145, MPN139, MPN138, MPN130, MPN127, MPN104, MPN100, MPN094, MPN038, MPN013, MPN675, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 81..100;   MP358 433582..433893
MPN485 complement(589030..589980) P02_orf316 g1674035 P02_orf316 more__, species specific lipoprotein see: MP353         MPN489, MPN444, MPN436 lc: 53..65 84..107 118..133 239..256 262..276; new_add; see MP 353 as longest representative; is also this MG homologue MP357 432215..433165
MPN486 589922..590365 P02_orf147 g1674034 P02_orf147 conserved hypothetical             unclear; psi-blast converged to the sequence after 2nd iteration; exp: RNA data from ZMBH, RNA-expressed; MP356 complement(431830..432273)
MPN487 590569..591795 nifS g1674033 P02_orf408 more__, bifunctional; nifS-like; also related to tRNA splicing protein spl 1; molecular function: classV pyridoxal-phosphate-dependent transferase; subunit to MP355; SEG 238-250 1DGD   MG336   lc: 238..250; more__, yurw protein, nifS family, clear by blast and exp evidence Pfam alignment PF00266 Transferases class-V b) however note Q 36-238 S 115-312 similar to tRNA splicing protein spl1 could perhaps also be involved in tRNA maturation in MP ?; furhtermore, E.coli nifS-like Gen is counterpart of mammalian selenocystein lyase; nitrogen fixation has also net yet been reported for MP, thus only the molecular function is sure;SUB, subunit, matches MP354; hypothesis sulfur scavenging, as the transferase gets selene or sulfur out, at least in the csdB E.coli homologue; JBC 274, 14768-14772 (1999); probably with broad enough specificity to do also other pyridoxal phosphate transfer reactions, e.g. aspartate aminotransferase (this latter function also recognized by Sternberg; not by genebank or swissprot); COGs describe NifS family as cysteine desulfurase related enzyme (leaving also some broader specificity open) MP355 complement(430400..431626)
MPN488 591798..592220 P02_orf140 g1674032 P02_orf140 new, nifU-like, complementing transferase subunit for MP354;       MG337   lc: 121..135; new, blast yurv BS Q1-96 S7-100 with 0.016 also similar to TP0615 nifU with 0.54 plus neighbourhood should be complementing subunit to the transferase below: SUB, subunit matches MP 355; hypothesis: matching MP354:could hold Fe-S for assembly Zheng et al., JBC 273, 13264-13272 (1998); in genebank MG / Sternberg only cons. hyp, not recognized as subunit. In COG 822 NifU homologs involved in Fe-S cluster formation; though COG fits in context of our hypothesis, safest is to state that this is the matching subunit to the transferase activity of MP355 MP354 complement(429975..430397)
MPN489 complement(592398..596300) P02_orf1300 g1674030 P02_orf1300 more__, species specific lipoprotein signal seq 1-25 domain 1 25-436 low cplx domain II 516-643 low cplx domain III 659-926 low cplx 949-1023 low cplx domain IV 1046-1214 C-term 516-643 low cplx 659     MG338 MPN485, MPN444, MPN442, MPN440, MPN439, MPN437, MPN436 sp: 1..25; lc: 461..489 500..515 621..640 644..658 933..948 1024..1045 1215..1229; new_add; Longest representative for MP357 and MP353 domain 1 5e-09 hits species specific lipoprotein Mycoplasma gallisepticum exp evidence: Avian Dis 1991 Jan-Mar;35(1):62-9,UI: 91229561; domain 2 again lipoprotein family domain 3 hypothetical lipoprotein; MP353 425895..429797
MPN490 complement(596816..597826) recA g1674029 P02_orf336 conf, recombination protein RecA   1REA DNA repair; replication; RECA PROTEIN CAN CATALYZE THE HYDROLYSIS OF ATP IN THE PRESENCE OF SINGLE-STRANDED DNA, THE ATP-DEPENDENT UPTAKE OF SINGLE-STRANDED DNA BY DUPLEX DNA, AND THE ATP-DEPENDENT HYBRIDIZATION OF HOMOLOGOUS SINGLE-STRANDED DNAS IT INTERACTS WITH LEXA CAUSING ITS ACTIVATION AND LEADING TO ITS AUTOCATALYTIC CLEAVAGE. MG339     clear full length; Q 37-322 S 48-332; C.glutamicum 9.5e-68 Literature/experiment: APPL. MICROBIOL. BIOTECHNOL. 42:575-580(1994), UI: 95134369 ; SUB, subunit, requires LexA to work; exp: RNA data from ZMBH, no expression, this is hypothetical ! However, this is a DNA repair protein, so check under condition of stress MP352 424369..425379
MPN491 597900..599324 P02_orf474 g1674028 P02_orf474 new, membrane nuclease     nucleotides; nuclease; membrane;   MPN333 sp: 1..16; lc: 175..212 262..296; new, exact exp evidence, expressed, antibodies, shown really in membrane; tr Q50321 (MNU)MEMBRANE NUCLEASE A.[MYCOPLASMA PULMONIS 6E-16 Q299-470 S291-463 nuclease exp with maxicells; PATHOGENICITY FACTOR J. Bacteriol. 181(6):1853-1860(1999),UI: 99173909; 2D gel elpo spot; sort of unconnected; exp: 2D-Gel data from ZMBH, TX-UF, 36kD (C-term), IEP 6.2 MP351 complement(422871..424295)
MPN492 complement(599463..600380) yjfW g1674027 P02_orf305 conf, similar to D-ARABINO-6-HEXULOSE 3-PHOSPHATE isomerase from E.coli   1BHW-A Energy metabolism, Sugars;ADD: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE ISOMERIZATION OF D-ARABINO-6-HEXULOSE 3-PHOSPHATE TO D-FRUCTOSE 6-PHOSPHATE       by similarity and neighbourhood; EC 2e-53 Q25-276 S8-261 in EC FUNCTION: ISOMERIZATION OF D-ARABINO-6-HEXULOSE 3-PHOSPHATE TO D-FRUCTOSE 6-PHOSPHATE. PATHWAY: PROBABLY PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE.HUMPI family; Story: would be operon, and small pathway formed by MP347-MP350 exp: RNA data from ZMBH, no expression, this is hypothetical ! really to check: Is this sugar inducible ?! MP350 421815..422732
MPN493 complement(600316..600972) yjfV g1674026 P02_orf218 new_conf, 3-hexulose-6- phosphate synthase     Energy metabolism, Sugars;ADD: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE CONDENSATION OF D-RIBULOSE 5-PHOSPHATE WITH FORMALDEHYDE TO FORM D-ARABINO-6-HEXULOSE 3-PHOSPHATE. HUMPS FAMILY the key enzyme of the RuMP cycle     sp: 1..18; lc: 123..136; known before in swissprot, HUMPS FAMILY; well characterized in BS Arch Microbiol 1989, UI: 89373409; BS e-09 to the best gene found in BS Q24-210 S21-204 exp: RNA data from ZMBH, only 32 degrees, RNA-expressed; perhaps only semantics, but the true function should be noted in the annotation. MP349 421223..421879
MPN494 complement(600974..601453) yjfU g1674025 P02_orf159 new_conf, similar to phosphotransferase protein II, component A, for pentitol, SGAT homolog   1A6J-A Energy metabolism, Sugars;ADD: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE PENTITOL PHOSPHOTRANSFERASE ENZYME II; transporter, phosphotransferase protein II, part of ribulose transporter (probably)       psi-blast: Clearly similar to the A component of enzyme II in a PTS system (EC 2.7.1.69); exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, Ges.; IEP at 6.4; new_conf swissprot MP348 420742..421221
MPN495 complement(601455..601742)   New identified New identified similar to PTS system: EIIB               347-348 420453..420740
MPN496 complement(601745..603727) yjfS g1674024 P02_orf660 new_conf, similar to phosphotransferase protein for pentitol from E.coli, SGAT homolog strong hint SMART: signal 1-36; SEG 4-15, 22-34 and 312-326; TM helices: Many, 11 high , 5 probable ones   Energy metabolism, Sugars;NEW: PART OF A SUGAR METABOLIC PATHWAY ALONG WITH SGAH AND SGAE putative transport protein first gene, see MP350; transporter; ribulose transprot (probably, perhaps broader)     sp: 1..36; tm: 73..93 101..121 162..182 194..214 229..249 309..329 362..382 421..441 450..470 480..500 614..634; lc: 400..413 639..651; protein (yjfS) homolog; psi-blast converges, but shows integral membrane protein and the E.coli SGAT similarity; similar to Swiss-Prot Accession Number P39301, from E. coli (which is the SGAT EC transporter) putative EC trapo protein SGAT 2e-63 Q 59-501 S 23-419;however, only by similarity of a similarity; makes more sense as part of an operon, see MP350 COULD ACT AS THE TRANSPORT PROTEIN FOR THE UNKNOWN PENTITOL SUBSTRATE OF THE SGA OPERON. SUBCELLULAR LOCATION: INTEGRAL MEMBRANE PROTEIN. INNER MEMBRANE (POTENTIAL). SIMILARITY: TO M.PNEUMONIAE SGAT HOMOLOG further strong hint SMART; exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, Gesamt; new_conf swissprot MP347 418468..420450
MPN497 complement(604155..604586) P02_orf143 g1674023 P02_orf143 new_conf, similar to PHOSPHOTRIESTERASE HOMOLOGY PROTEIN     if the function is exactly that then this would give: Intermediary metabolism, detoxification, phosphates; Aryl dialkyl phosphate + H(2)O = dialkyl phosphate + an aryl alcohol   MPN062 tm: 102..122; lc: 76..94; PHOSPHOTRIESTERASE HOMOLOGY PROTEIN 0.001 Q6-143; S59-182; E.coli only hint HYDROLASE; ZINC; 3D server yields nothing; sort of unconnected; COG 1735 confirms this MP346 417609..418040
MPN498 604897..605625 araD g1674020 P02_orf242 conf, L-ribulose-5-phosphate 4-epimerase   2FUA Energy metabolism, Pentose Phosphate pathway; L-ribulose-5-phosphate 4-epimerase (araD); L-ribulose 5-phosphate = D-xylose 5-phosphate;     lc: 59..71; EC 9e-56 Q 5-236 S 1-231 NAR 18:6722-6722(1990),UI: 91067495; note that the enzyme may have broader specificity, also related to EC fuculose aldolase classII 8.7e-07 Q 7-208 S 4-187 exp JMB 259, 458-466 (1996); part of a story, Peer has similar example, finidng out the further activities of PPP; MP345 complement(416570..417298)
MPN499 605579..606070 P02_orf163 g1674019 P02_orf163 conserved hypothetical             URF, real protein ? psi blast converged exp: RNA data from ZMBH, RNA-expressed; MP344 complement(416125..416616)
MPN500 606218..607801 P02_orf527V g1674018 P02_orf527V conf, see: MP013         MPN144, MPN141, MPN132, MPN131, MPN128, MPN099, MPN468, MPN409, MPN370, MPN286, MPN203, MPN202 lc: 9..26 43..55 96..117 375..395 489..515;   MP343 complement(414394..415977)
MPN501 608167..608757 P02_orf196 g1674017 P02_orf196 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 116..194; URF; exp: RNA data from ZMBH, RNA-expressed; MP342 complement(413438..414028)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN502 609202..610470 P02_orf422V g1674016 A05_orf278 conf,see: MP013         MPN141, MPN128, MPN101, MPN462, MPN370, MPN205 lc: 23..39 131..140 170..188; konvergiert - Himmelreich,R., Hilbert,H., Plagens,H., Pirkl,E., Li,B.C. and Herrmann,R. TITLE Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae JOURNAL Nucleic Acids Res. 24 (22), 4420-4449 (1996), aber ist das 100%ig sicher, seine Expertenmeinung ? aber zusaetzlich: Percent Similarity: 44.521 Percent Identity: 21.918 bestfit Percent Similarity: 44.218 Percent Identity: 21.769 gap P11311 is well characterizedRA SU C.-J., TRYON V.V., BASEMAN J.B.; "Cloning and sequence analysis of cytadhesin P1 gene from Mycoplasma pneumoniae."; INFECT. IMMUN. 55:3023-3029(1987),UI: 8805759; MP341 complement(411725..412993)
MPN503 611025..612170 P02_orf381 g1674015 P02_orf381 new_conf, protein family involved in cytadherence, see: MP012         MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN468, MPN464, MPN414, MPN367, MPN366 lc: 61..78; exp: RNA data from ZMBH, RNA-expressed; MP339 complement(410025..411170)
MPN504 612740..613120 P02_orf126 g1674014 P02_orf126 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 97..125; lc: 43..55; URF; exp: RNA data from ZMBH, RNA-expressed; MP338 complement(409075..409455)
MPN505 complement(613188..613949) P02_orf253 g1674013 P02_orf253 conserved hypothetical see: MP199         MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN551, MPN467, MPN466, MPN411, MPN369, MPN271 sp: 1..24;   MP337 408246..409007
MPN506 614865..617246 P02_orf793 g1674012 P02_orf793 conserved hypothetical, see: MP631         MPN152, MPN147, MPN146, MPN098, MPN097, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199 sp: 1..27; cc: 526..552; lc: 38..52 218..237 491..505 558..570; see comments to MP631. MP336 complement(404949..407330)
MPN507 617366..618457 P02_orf363V g1674010 P02_orf363V conf, type I restriction enzyme ecokI specificity protein (hsdS) homolog; similar to GenBank Accession Number E64055, from H. influenzae     DNA metabolism; restriction enzyme;   MPN089, MPN615, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201   representative for family MP066 MP227 MP335 MP471 MP493 MP545 MP546 MP550 MP630 1.7e-20 till 326; to M.pulmonis; exp evidence DYBVIG K., SITARAMAN R., FRENCH C.T. PNAS(1998), UI: 99030671 ; story note: A family of phase-variable restriction enzymes with differing specificities generated by high- frequency gene rearrangements; SUB, subunit, for all family memebers, this is always hsdS, subunits hsdR, hsdM are also required; Story: Recombination between these different genes, see PNAS article; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP335 complement(403738..404829)
MPN508 complement(618485..620014) P02_orf509 g1674009 P02_orf509 new, membrane export protein family coil 201-256       MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN234 cc: 201..256; new, protein gets exported over the membrane and the membrane translocation function affects expression of antigenic translational products; MP334 representative of the family MP105 MP106 MP330 MP331 MP332 MP333 MP597 blast, psi whole protein: is a family, N-term part lipoprotein like; but very closed family; more iterations are possible; SMART: nothing known; C-terminal part even after 4 psi-blast iterations still hypothetical membrane protein; converges at step 7, full family only in MP and MG but many members N-terminal part: 7e-04 M.hyorhinis Q41-200 S564-742 exp evidence:Sequence and TnphoA analysis of a Mycoplasma hyorhinis protein with membrane export function. Yogev,D. et al.J. Bacteriol. 173 (6), 2035-2044 (1991),UI: 91161521, believe as convincing hint from a related organism and clear experiment; caveat: Only part of protein; MP334 402181..403710
MPN509 complement(620561..621844) P02_orf427 g1674008 P02_orf427 new, membrane export protein family see: MP334         MPN049, MPN048, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN508, MPN234, MPN161 cc: 109..156; new, see MP 334 MP333 400351..401634
MPN510 complement(622874..624250) P02_orf458 g1674007 P02_orf458 new, membrane export protein family see: MP334         MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN509, MPN508, MPN234 cc: 187..224; new, see MP 334 MP332 397945..399321
MPN511 complement(624862..625644) F04_orf260V g1674006 F04_orf260V new, membrane export protein family see: MP334         MPN049, MPN048, MPN042, MPN041, MPN036, MPN035, MPN510, MPN509, MPN508, MPN234 lc: 193..207; new, see MP 334 MP331 396551..397333
MPN512 complement(625675..626139) F04_orf154 g1674005 F04_orf154 new, membrane export protein family see: MP334         MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN510, MPN509, MPN508, MPN234, MPN161 cc: 119..153; new, putative, see MP334 MP330 396056..396520
MPN513 complement(626917..627369) F04_orf150 g1674004 F04_orf150 conserved hypothetical             converged after first psi-blast on itself exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP329 394826..395278
MPN514 complement(627886..628248) F04_orf120 g1674003 F04_orf120 conserved hypothetical             URF, hits only replication like regions, not convincing exp: RNA data from ZMBH, RNA-expressed; MP328 393947..394309
MPN515 complement(628410..632282) rpoC g1674001 F04_orf1290 conf, DNA-directed RNA polymerase beta' chain     Transkription; MG340   lc: 3..20 330..342 1221..1233; DNA-directed RNA polymerase beta' chain; whole family Thermotoga maritima 1E-180 S 464-867 Q 237-644 exp. evidence, UI: 94232816, NAR 21, 4904-4908 (1993;sub, subunit, one further is MP326, but there is the alpha-subunit at least missing; MP327 389913..393785
MPN516 complement(632286..636461) rpoB g1674000 G12_orf1391o conf, RNA polymerase beta subunit seg 166-177 potential TM helices 181-201; 499-519; 660-680; 752-772   Transkription; MG341     RNA polymerase beta subunit clear hit by blast; whole family; exp data e.g. for R.prowazecki causative agent for typhus Q 411-1052; S 345-975;1.1e-229 J. BACTERIOL. 180:2118-2124(1998), UI: 98215179; sub, subunit, one further is MP327, but there is the alpha-subunit at least missing; MP326 385734..389909
MPN517 complement(636554..637054) G12_orf166a g1673999 G12_orf166a new_conf, suggest reductase homologue   1QRD-A   MG342     new_conf, reductase homologue, tentative: Streptomyces cyanogenus Q2-154 S 9-160 0.037 AAD13563 Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis, UI: 99132695; also classified as reductase in search for homologous structure; unconnected; not found in GenebankMG or swissprot(cons hyp), but by Sternberg as NADPH quinon-reduktase. MP325 385141..385641
MPN518 complement(638147..639193) G12_orf348 g1673998 G12_orf348 conserved hypothetical       MG343     blast unclear, nucleotide binding, processing or so; unconnected MP324 383002..384048
MPN519 complement(639196..640014) lip3 g1673997 G12_orf272V conf, triacylglycerol lipase (lip) 3   1A7U-A Fatty acid and phospholipid metabolism; triacylglycerol lipase; Triacylglycerol + H2O = diacylglycerol + a fatty acid anion. see also MP396, MP368 with similar activity MG344 MPN473, MPN445 lc: 137..148; triacylglycerol lipase (lip) 3; experimental certified for M.mycoides; full length similarity RAWADI G., LALANNE J.L., ROULLAND-DUSSOIX D.,UI: 95309706; Cloning and characterization of the lipase operon from Mycoplasma mycoides subspecies mycoides LC.Gene. 1995 May 26;158(1):107-11 MP323 382181..382999
MPN520 complement(640132..642717) ileS g1673995 G12_orf861 conf, isoleucine-tRNA ligase     protein translation MG345 MPN023, MPN480, MPN384 lc: 225..239; very clear by Blast full length; e.g. E.coli exp. many papers. MP322 379478..382063
MPN521 642760..643260 ygl3 g1673994 G12_orf166b new_conf, putative rRNA methylase     protein translation (putative) MG346 MPN355   new_conf probably Koonin spotted it, too; smart nothing. blast clear methyltransferase, hypothetical family EC e-23 Q6-158 S2-150 KOONIN E.V., RUDD K.E.; "SpoU protein of Escherichia coli belongs to a further discovered family of putative rRNA methylases."; NUCLEIC ACIDS RES. 21:5519-5519(1993). SIMILARITY: BELONGS TO THE RNA METHYLTRANSFERASE TRMH FAMILY. STRONG, TO H.INFLUENZAE HI0766. spou family; UI: 94089409.CAUTION: POSSIBLY IDENTICAL TO GLTE. guanosine-o-methylftransferase EC only 0.25; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP321 complement(378935..379435)
MPN522 643251..643883 G12_orf210V g1673993 G12_orf210V new_conf, similar to methyltransferase   1XVA-A methyltransferase, unconnected MG347     new_conf, BAHR A., HANKELN T., FIEDLER T., HEGEMANN J., SCHMIDT E.R.; "Molecular analysis of METTL1, a novel human methyltransferase-like gene with a high degree of phylogenetic conservation.", UI 99263505; 4e-05 Q34-155 S71-197 CAA77240; and enough other homology/ further hits evidence for methyltransferase. Found also in EMBL 3D predictor, not found in Chothia. found in latest COGs 0220 pred. S-adensoyldep. methyltr.;old genbank pointer F64148 leeds into nothing;exp: RNA data from ZMBH, expressed at 32 degrees, RNA-expressed; Methyltransferase family was recognized by Sternberg, not yet by Genebank MG; we can add the novel family; MP320 complement(378312..378944)
His-tRNA(CAC) 643913..643988 mptgh                     643913..643988 complement(378207..378282)
MPN523 complement(644038..644955) G12_orf305 g1673992 G12_orf305 more_, probably membrane component, similar to STARP antigen Seg 2-31 signal 1-30 seg 259-279     MG348 MPN128 sp: 1..30; lc: 259..279; more_, similar to STARP antigen [Plasmodium reichenowi] 2e-04 Q43-257 S190-404; MP319 377240..378157
Leu-tRNA(CTC) complement(644970..645055)                       complement(644970..645055) 377140..377225
MPN524 complement(645545..646051) G12_orf168 g1673991 G12_orf168 hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 104..167; lc: 43..55; URF exp: RNA data from ZMBH, RNA-expressed; MP318 376144..376650
MPN525 646644..647885 G12_orf413 g1673990 G12_orf413 conserved hypothetical Seg 225-241     MG349   lc: 224..243; MG349 homolog, from M. genitalium psi blast converged; exp: RNA data from ZMBH, expressed at 32 degrees, RNA-expressed; MP317 complement(374310..375551)
MPN526 647866..648852 G12_orf328b g1673989 G12_orf328b conserved hypothetical       MG350   cc: 159..187; lc: 28..41; MG350 homolog, from M. genitalium; psi nothing else; exp: RNA data from ZMBH, RNA-expressed; MP316 complement(373343..374329)
MPN527 complement(649107..649784) G12_orf225 g1673988 G12_orf225 new, putative membrane integrated oxidoreductase TM 20-40 Seg 20-35 TM 56-76 TM 88-108 TM 121-141 seg 127-147 possible Trans 144-164 TM 173-193 (6 TM helices, for sure a membrane integrated protein)   membrane oxidoreductase, unconnected MG350.1   sp: 1..47; tm: 56..76 88..108 121..141 173..193; new, putative membrane close oxidoreductase indications: MG close homologue NADH dehydrogenase subunit 5 [Onchocerca 38 0.069 Q 91-217 S 387-528 and a lot of other NADH UBIQUINONE dehydrogenases SMART 6 TM helices, pointing to membrane integrated protein; SUB, subunit; unconnected; MP315 372411..373088
MPN528 649839..650393 ppa g1673987 G12_orf184 conf, inorganic pyrophosphatase   117E-A Central intermediary metabolism, Phosphorous compounds;inorganic pyrophosphatase (ppa); PYROPHOSPHATE + H(2)O = 2 ORTHOPHOSPHATE; MG351     whole family A.thaliana 4.3e-24 Q 5-162; S 50-207; whole family PLANT MOL. BIOL. 16:345-348(1991) UI: 91370878. MP314 complement(371802..372356)
MPN529 complement(650917..651246) G12_orf109 g1673985 G12_orf109 new_conf, bacterial histone like protein     protein translation MG353     new_conf: Koonin says DNA-binding (Tobias) not clear; converges quickly in psi-blast; story: there is a protein in the MP313-MP314 intergenic region (see Mikita's list) - this and MP313 are together in MG and BS (jopC jopB) - they may interact forming a functional unit MP313 370949..371278

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN530 651395..651805 G12_orf136 g1673984 G12_orf136 conserved hypothetical     protein translation MG354     not clear; converges quickly in psi-blast; exp: RNA data from ZMBH, RNA-expressed; MP312 complement(370390..370800)
MPN531 complement(651802..653949) clpB g1673983 G12_orf715 conf, ATP-dependent protease binding subunit ClpB No known SMART domains detected; coil 266-352; seg 391-402 seg 409-423 1D2N-A, 1D2N-A protein translation MG355 MPN138, MPN161 cc: 266..351; lc: 409..423; clpB protein family member, ATPase subunit 4.9e-167 to EC Q 10-709 S 156-856 Lit BIOCHEM. BIOPHYS. RES. COMMUN. 180:1222-1226(1991) J. BACTERIOL. 173:4254-4262(1991) PNAS 87, 3513-3517 (1990); SUB, subunit;UI: 92062147. MP311 368246..370393
MPN532 complement(654125..654973) licA g1673982 G12_orf282b wrong_, stronger similar to choline kinase   1A06 Fatty acid and phospholipid metabolism; ATP + choline = ADP + O-phosphocholine MG356     wrong in genbank, licA comes in first psi blast iteration at 0.013; however choline kinase from Streptococcus pneumoniae is closer and has 5e-04 MP310 367222..368070
MPN533 complement(654981..656153) ackA g1673981 G12_orf390 conf, acetate kinase     Central intermediary metabolism, Other; acetate kinase (ackA); Note: Propanoate also acts as acceptor, but more slowly. acetate + ATP = ADP + acetyl phosphate; MG357     clear hit, whole family; EC 8e-71 Q 1-388 S 1-399 J. Bacteriol. 171 (1), 577-580 (1989) UI: 89123075. MP309 366042..367214
MPN534 656494..656916 G12_orf140b g1673980 G12_orf140b conserved hypothetical, RNA-expressed, see comment             real function ? psi blast first: alone; converged with one sequence; SMART nothing; exp: RNA data from ZMBH, RNA-expressed; MP308 complement(365279..365701)
MPN535 656922..657542 ruvA g1673979 G12_orf206 conf, Holliday junction DNA helicase RuvA   1BVS-A transcription, DNA repair MG358     Q 64-192; S 61-200 EC 4e-05 Lit J.Bacteriol 170, 4322-4329, UI: 88314937.subunit, sub; MP307 complement(364653..365273)
MPN536 657517..658440 ruvB g1673978 G12_orf307 conf, Holliday junction DNA helicase RuvB   1D2N-A transcription, DNA repair MG359 MPN671   clear; EC 3e-50; Q8-303 S25-327; Lit J.Bacteriol 170, 4322-4329, UI: 88314937. subunit, sub; MP306 complement(363755..364678)
MPN537 complement(658426..659664) mucB g1673977 G12_orf412 conf, UV protection protein MucB     DNA repair MG360 MPN535 lc: 20..30; full length; EC exp Q 31-334, S13-328, 5e-14 PNAS 82, 4331-4335 (1985)UI: 85242678; note umuDC does not complement mucAB; SUB, subunit; exp: RNA data from ZMBH, only once low expressed at 32 degrees (but should only be expressed with UV, shouldn't it ?) MP305 362531..363769
MPN538 659782..660267 rpsJ g1673976 G12_orf161 conf, ribosomal protein L10     protein translation MG361     SUB; full length; whole family EC 9E-06 exp evidence, UI: 76257859. MP304 complement(361928..362413)
MPN539 660305..660673 rplL g1673975 G12_orf122 conf, ribosomal protein L7/L12 ('A' type)   1CTF protein translation MG362   tm: 30..50; SUB; full length; whole family EC 4e-13 Lit Eur J Biochem 34, 138-152 (1973) UI: 73169380 MP303 complement(361522..361890)
MPN540 660680..660853 rpmF g1673974 G12_orf57 conf, ribosomal protein L32 SEG 6-20 SEG 21-57   protein translation MG363   lc: 6..20; SUB; full length, whole family; EC exp. UI: 76119562 MP302 complement(361342..361515)
MPN541 complement(660863..661126) rpsT g1673973 G12_orf87 conf, ribosomal protein S20     protein translation MG363.1     SUB; full length; whole family; Lit ref EC 0.00011 FEBS Lett 68, 110-114 (1976) UI: 77003692 MP301 361069..361332
MPN542 661187..661843 G12_orf218 g1673971 G12_orf218 conserved hypothetical       MG364   sp: 1..33; cc: 184..217; ?; unknown function; signal 1-33; coil 184-218 middle psi converged 1st iteration MG13 random reading frame; exp: RNA data from ZMBH, highly expressed, RNA-expressed; MP300 complement(360352..361008)
MPN543 661848..662783 fmt g1673970 G12_orf311 conf, methionyl-tRNA formyltransferase   1FMT-A   MG365     full length; e.g. 2-103 to EC 5-304 exp EC evidence: J Bacteriol 174, 4294-4301 (1992) UI: 92325012,and J Bacteriol 175, 993-1000 (1993),UI: 93163064. exp: RNA data from ZMBH, only once, 32 degrees; MP299 complement(359412..360347)
MPN544 662783..664777 G12_orf664 g1673969 G12_orf664 conserved hypothetical SEG 80-94 SEG 223-234     MG366     psi blast converged; 3rd part 235-664 has some low but reoccuring similarity to nuclear polyhedral protein p74 MP298 complement(357418..359412)
MPN545 complement(664761..665609) rnc g1673968 G12_orf282a conf, ribonuclease III       MG367   lc: 265..280; big family, EC J. BACTERIOL. 171:2581-2590(1989)UI: 89213943, 4.1e-11 Q 56-199 S 38-182 MP297 356586..357434
MPN546 complement(665599..666585) plsX g1673967 G12_orf328a conf, fatty acid/phospholipid synthesis protein PlsX     Fatty acid and phospholipid metabolism; what plsX exactly does is unclear MG368     fatty acid/ phospholipid synthesis protein PlsX is believable EC 1.4e-27 4-314 S3-318 part of the cluster plsX-fabH-fabD-fabG-acpP-fabF at min 24; plsX itself is transcribed. J Bacteriol 1997, 179(23):7257-63, UI: 9805383;sn-glycerol-3-phosphate acyltransferase (plsB) E. coli plsX, a gene that plays a poorly understood role in phospholipid synthesis J Bacteriol 1996 Aug;178(16):4794-800,UI: 96326321, but clear genetic evidence: Isogenic plsB+ plsX+, plsB+ plsX50, and plsB26 plsX+ strains grew equally well on glucose minimal medium without sn-glycerol-3-phosphate J Bacteriol 1984 Nov;160(2):711 MP296 355610..356596
MPN547 complement(666585..668261) G12_orf558 g1673966 G12_orf558 new_conf, dihydroacetone kinase No known domains from SMART; SEG 300-314 SEG 523-538     MG369   lc: 523..538; new_conf, 1st domain (till 300)shows clear and high e value homology to many dihydroxyacetone kinases but this function may be further modified, regulated by the rest of the protein exp: RNA data from ZMBH, only once, 32 degrees; confirmed also by COG1461, "related to dihydroxy acetone kinase" MP295 353934..355610
MPN548 complement(668316..669296) G12_orf326 g1673965 G12_orf326 new, pseudouridine synthase 15-72, S4 RNA binding domain;   uracil + D-ribose 5P -> pseudouridine 5P + water MG370 MPN292 lc: 77..89; SUB; new, ribosomal large subunit pseudouridine synthetase belongs to the rlu family; EC query res 16-288, UI: 99190868, Acta Crystall D Biol Crystallogr (1999) 55, 302-304; S4 RNA binding domain (SMART) from res. 15-72 e=9.9-06; COG564 states already predicted pseudo uridilate synthase family; here we upgrade this new annotation further: More specific and giving a direct experimental link; MP294 352899..353879
MPN549 complement(669283..670260) G12_orf325 g1673964 G12_orf325 new_conf, phosphodiesterase 15-315, DHH domain;     MG371 MPN140 lc: 32..49; new_conf, belongs to the MGPA/MG371 family; pfam1368 phosphodiesterase; furthermore the DHH Smart domain is given on the left. Koonin and Aravind DHH domain description UI98138617 . Domain covers the protein MP293 351935..352912
MPN550 complement(670253..671416) G12_orf387 g1673963 G12_orf387 new_conf, Thiamin biosynthesis protein   1GPM-A, 1NSY-A   MG372   lc: 93..104; new_conf, e.g. EC has e=3.7-33 Characterization of thiI a gene involved in thiazole biosynthesis in S.typhimurum J Bact 179, 4399-4402 (1997); exp: RNA data from ZMBH, RNA-expressed; thoguh Sternberg and GenebankMG latest version fail to reckognize the thiI function (just say NTP utilizing pyrophosphatase), swissprot has already this annotation. MP292 350779..351942
MPN551 complement(671403..672248) G12_orf281 g1673962 G12_orf281 conserved hypothetical       MG373 MPN505   orthologue MG; Psi-blast converged; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP291 349947..350792
MPN552 complement(672255..673064) G12_orf269 g1673961 G12_orf269 conserved hypothetical       MG374     psi-blast converged; MG clear orthologue exp: RNA data from ZMBH, no expression, this is hypothetical; MP290 349131..349940
MPN553 complement(673057..674751) thrSv g1673960 G12_orf564 conf, threonyl-tRNA synthetase   1ATI-A, 1SER-B protein translation MG375   sp: 1..17; clear, full protein; exp. evidence, e.g. yeast NAR 13, 6171-6183 (1985) UI: 86016080; RNA data from ZMBH: no expression, this is hypothetical; MP289 347444..349138
MPN554 complement(674751..675065) G12_orf104 g1673959 G12_orf104 conserved hypothetical       MG376     similar to single-stranded binding protein Staph. U96108 with e=0.033 exp: RNA data from ZMBH, RNA-expressed; MP288 347130..347444
MPN555 complement(675067..675648) H03_orf193o g1673958 H03_orf193o conserved hypothetical       MG377     psi-blast converged SMART, pfam mute; one domain protein; exp: RNA data from ZMBH, RNA-expressed; MP287 346547..347128
MPN556 complement(675691..677304) argS g1673957 H03_orf537 conf, arginyl-tRNA synthetase   1GLN   MG378   lc: 504..518; exp: _BRELA MP286 344891..346504
MPN557 677332..679170 gidA g1673956 H03_orf612 new_conf, NADH-binding oxidoreductase GidA   1FEA-A   MG379 MPN390   new_conf, in last version of COGs, COG 0445 correctly (as far as we know)annotated as NAD/FAD-utilizing enzyme apparently involved in cell division MP285 complement(343025..344863)
MPN558 679163..679738 gidB g1673955 H03_orf191 new_conf, methyltransferase GidB   1BHJ-A   MG380     new_conf, in last version of COGs; COG0357 correctly (as far as we know) annotated as Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division MP284 complement(342457..343032)
MPN559 679692..680399 H03_orf235 g1673954 H03_orf235 conserved hypothetical       MG381     exp: RNA data from ZMBH, no expression, this is hypothetical ! MP283 complement(341796..342503)

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
Arg-tRNA(AGA) complement(680400..680475) mptgab                     complement(680400..680475) 341720..341795
MPN560 complement(680477..681793) arcA g1673953 H03_orf438 conf, arginine deiminase     Energy metabolism; Amino acids and amines; arginine + H2O = citrullin + NH3; note that there is a similar enzyme at MP531/MP532;   MPN305, MPN304   exp: Bacillus licheniformis pheno: growth on arginine? needs also transporter and arcB (ornithine carbamoyltransferase) and arcD (putative arginine-ornithine antiporter), arcC (carbamate kinase) not in MG MP282 340402..341718
MPN561 681847..682488 udk g1673952 H03_orf213 conf, uridine kinase   1A7J Purines, pyrimidines, nucleosides and nucleotides, Nucleotide and nucleoside interconversions; uridine kinase (udk); ATP + Uridine = ADP + UMP. Note: Cytidine works also; MG382     exp: _ecoli can also act on cytidine?! MP281 complement(339707..340348)
MPN562 complement(682485..683231) outB g1673951 H03_orf248 conf, probable NH(3)-dependent NAD(+) synthetase   1NSY-A nucleotide metabolism, cofactors; NAD synthase; ATP + deamido-NAD(+) +NH3 = AMP + diphosphate + NAD+; L-glutamine also acts, more slowly, as amido-donor (cf. EC 6.3.5.1). MG383 MPN422   exp: _RHOCA; exp: RNA data from ZMBH, but only low expression once (282) at 32 degress; MP280 338964..339710
MPN563 complement(683224..684525) obg g1673950 H03_orf433 conf, small GTPase OBG involved in cell growth domain 1-160 domain 2 161-300 domain 3 301-ct 1AIP-A   MG384 MPN026, MPN568 lc: 32..44; domain 161-300 is small GTPase, nt/ct OBG-specific exp: _BACSU SPO0B-ASSOCIATED GTP-BINDING PROTEIN MP279 337670..338971
MPN564 complement(684729..685784) adh g1673949 H03_orf351 less, similar to NADP-dependent alcohol dehydrogenase   1YKF       tm: 167..187; exp: Thermoanaerobacter brockii MP278 336411..337466
MPN565 complement(685998..686456) H03_orf152 g1673948 H03_orf152 conserved hypothetical       MG384.1   sp: 1..42; tm: 43..63 70..90; lc: 133..151; 100aa hydrophobic, 1 huge tm? ?URF; exp: RNA data from ZMBH, RNA-expressed; MP277 335739..336197
MPN566 complement(686626..687339) glpQ g1673947 H03_orf237 less, Glpq or Uplq glycerophosphoryl diester phosphodiesterase     Central intermediary metabolism, Other; glycerophosphoryl diester phosphodiesterase(glpQ); as is MP421 - e.g. different allosteric regulation, specificity etc. ? glycerophosphodiester + H2O = an alcohol + sn-glycerol 3-phosphate; MG385 MPN420 cc: 114..139; exp: _BACSU: glpq clarification needed whether Glpq or Uplq MP276 334856..335569
MPN567 complement(687343..690453) P200 g1673946 D02_orf1036o conf, similar to cyto adherence proteins 170-225, repeated domain 226-280, repeated domain 630-680, repeated domain 850-899, repeated domain 900-945, repeated domain 946-990 repeated domain     MG386 MPN119, MPN452, MPN447, MPN343 lc: 353..373 397..411 486..501 540..557 565..601 604..626 707..721 726..758 770..787; story: contains a domain, exclusive to MP/MG, common to another cytadherence protein (MP394) and to a protein with probable cochaperone activity (MP035) MP275 331742..334852
MPN568 complement(690553..691428) spg g1673945 D02_orf291 more_, small GTPase ERA involved in regulating metabolism and cell division   1AIP-A cell division MG387 MPN008, MPN656, MPN563, MPN475 lc: 95..110; exp: _ecoli exp: _salty check other GTPases! neighborhood with hemolysin export; unconnected; only once expressed at 32 degree, but probably truly expressed; MP274 330767..331642
MPN569 complement(691416..691742) D02_orf108 g1673944 D02_orf108 new_conf, predicted metalloenzyme interacting with hemolysin       MG388     new_conf, koonin: zn-dependent enzyme; story; higher order: hemolysin interaction; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP273 330453..330779
MPN570 complement(691864..692253) D02_orf129 g1673943 D02_orf129 conserved hypothetical       MG389   sp: 1..21; cc: 84..109; exp: RNA data from ZMBH, RNA-expressed; MP272 329942..330331
MPN571 complement(692255..694237) lcnDR3 g1673942 D02_orf660 new_conf, similar to hemolysin ABC-type exporter     Transporter, ABC family; peptide toxin secretion, probably hemolysin efflux; MG390 MPN433, MPN193 tm: 150..170 188..208 266..286 289..309 402..422; lc: 79..93 473..488 586..601; new_conf; story; exp: _BACSU : sublancin exporter; exp: Enterococcus faecalis:hemolysin secretion protein CylB; higher order: neighborhood connection to hymolysin and a GTPase and a hypotetical protein; exp: RNA data from ZMBH, no expression, this is hypothetical; but confirmed by COG1132: ABC-type multidrug/protein/lipid transport system, ATPase component MP271 327958..329940
MPN572 complement(694341..695678) D02_orf445 g1673940 D02_orf445 more_, similar to CYTOSOL AMINOPEPTIDASE (LEUCINE AMINOPEPTIDASE) (LAP) 1-120;hypothetical 121-ct; catalytic 1BLL-E   MG391   lc: 253..270; exp: AMPL_RICPR additonal hypothetical domain 1-120 MP270 326517..327854
MPN573 complement(695692..697323) groEL g1673939 D02_orf543 conf, heat shock protein GroEL   1DER-A chaperone MG392     sub:hsp60 with GroES (MP268) MP269 324872..326503
MPN574 complement(697326..697676) groES g1673938 D02_orf116 conf, heat shock protein GroES   1AON-O chaperone MG393     sub:hsp60 with GroEL (MP269) MP268 324519..324869
MPN575 complement(697864..698250) D02_orf128 g1673937 D02_orf128 conserved hypothetical           tm: 48..68 91..111; tm, ?URF exp: RNA data from ZMBH, only low expression twice at 32 degrees, still dubious; MP267 323945..324331
MPN576 complement(698685..699905) glyA g1673936 D02_orf406 conf, serine hydroxymethyltransferase   1TPL-A Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid;serine hydroxymethyltransferase (glyA);5,10-methylenetetrahydrofolate + glycine + H2O = tetrahydrofolate + L-serine; MG394   lc: 381..395; exp: Acinetobacter radioresistens MP266 322290..323510
MPN577 complement(700067..701107) D02_orf346 g1673935 D02_orf346 see: MP072, conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580 lc: 238..250; exp: RNA data from ZMBH, only 32 degrees once; MP265 321088..322128
MPN578 701545..701847 D02_orf100 g1673934 D02_orf100 conserved hypothetical             ?URF exp: RNA data from ZMBH, RNA-expressed; MP264 complement(320348..320650)
MPN579 complement(701863..702192) D02_orf109 g1673933 D02_orf109 conserved hypothetical         MPN350 sp: 1..44; tm: 53..73; tm, ?URF exp: RNA data from ZMBH, RNA-expressed; MP263 320003..320332
MPN580 complement(702334..702756) D02_orf140 g1673932 D02_orf140 see: MP072, conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN589, MPN588, MPN586, MPN584, MPN582, MPN577     MP262 319439..319861
MPN581 complement(702824..703621) D02_orf265V g1673931 D02_orf265V see: MP072, conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN590, MPN588, MPN587, MPN586, MPN585, MPN583, MPN582, MPN577     MP261 318574..319371
MPN582 complement(703797..705116) D02_orf439 g1673930 D02_orf439 see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN581, MPN580, MPN577 sp: 1..25; Less, no further evidence for lipoprotein MP260 317079..318398
MPN583 complement(705554..706231) D02_orf225L g1673928 D02_orf225L see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN588, MPN586, MPN585, MPN582, MPN581, MPN577 lc: 32..49;   MP259 315964..316641
MPN584 complement(706735..707142) D02_orf135L g1673927 D02_orf135L see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN589, MPN588, MPN586, MPN582, MPN580, MPN577 lc: 26..44;   MP258 315053..315460
MPN585 complement(707204..708112) D02_orf302 g1673926 D02_orf302 see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN590, MPN588, MPN587, MPN586, MPN583, MPN582, MPN581, MPN577 sp: 1..25; Less, no further evidence for lipoprotein MP257 314083..314991
MPN586 complement(708186..709229) D02_orf347 g1673925 D02_orf347 see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN589, MPN588, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 lc: 72..83 247..263;   MP256 312966..314009
MPN587 complement(709105..709557) D02_orf150 g1673924 D02_orf150 see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN590, MPN588, MPN585, MPN582, MPN581, MPN577 sp: 1..29; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP255 312638..313090
MPN588 complement(709615..711210) D02_orf531 g1673923 D02_orf531 see: MP072 conserved hypothetical       MG395 MPN084, MPN083, MPN592, MPN591, MPN590, MPN589, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 sp: 1..25; lc: 40..54; Less, no further evidence for lipoprotein MP254 310985..312580

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN589 complement(711423..711896) D02_orf157L g1673922 D02_orf157L see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN588, MPN586, MPN584, MPN582, MPN580, MPN577     MP253 310299..310772
MPN590 complement(712037..712690) D02_orf217L g1673921 D02_orf217L see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN591, MPN588, MPN587, MPN585, MPN582, MPN581, MPN577 sp: 1..31; Less, no further evidence for lipoprotein exp: RNA data from ZMBH, no expression, this is hypothetical ! MP252 309505..310158
MPN591 complement(712847..713908) D02_orf353V g1673920 D02_orf353V see: MP072 conserved hypothetical         MPN084, MPN083, MPN592, MPN590, MPN589, MPN588, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577, MPN442     MP251 308287..309348
MPN592 complement(714431..715996) D02_orf521 g1673919 D02_orf521 conserved hypothetical see: MP072         MPN084, MPN083, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577 sp: 1..25; less, tm's; ?URF exp: RNA data from ZMBH, RNA-expressed; note that the orthologue of MG395 is MP254. MP250 306199..307764
MPN593 complement(716097..716465) D02_orf122b g1673917 D02_orf122b conserved hypothetical         MPN085 tm: 40..60 74..94; tm's; ?URF exp: RNA data from ZMBH, RNA-expressed; MP249 305730..306098
MPN594 complement(716691..717059) D02_orf122a g1673916 D02_orf122a conserved hypothetical           tm: 33..53 86..106; tm's; ?URF exp: RNA data from ZMBH, RNA-expressed; MP248 305136..305504
MPN595 complement(716977..717435) lacA g1673915 D02_orf152 more__, GALACTOSE-6-PHOSPHATE ISOMERASE AND RIBOSE 5-PHOSPHATE ISOMERASE B; bifunctional     Energy metabolism, Sugars; galactose-6-phosphate isomerase (if no further subunit is required; D-galactose 6-phosphate = D-tagatose 6-phosphate; bifunctional 2nd function: RIBOSE 5-PHOSPHATE ISOMERASE; D-ribose 5-phosphate = D-ribulose 5-phosphate MG396   tm: 62..82; seems to be able to perform 2 reactions; exp: 44%id RIBOSE 5-PHOSPHATE ISOMERASE B RPIB_ECOLI; exp: 45%id GALACTOSE-6-PHOSPHATE ISOMERASE LACB SUBUNIT (lacA) Rickettsia; also: 41%id galactosidase acetyltransferase (lacA) helicobacter (doubt); sometimes only subunit? MP247 304760..305218
MPN596 complement(717435..719144) D02_orf569 g1673914 D02_orf569 conserved hypothetical       MG397   sp: 1..31; cc: 189..215 282..312; lc: 398..410; signal sequence; coiled coil; exp: RNA data from ZMBH, RNA-expressed; MP246 303051..304760
MPN597 complement(719144..719545) atpC g1673913 D02_orf133a conf, ATP synthase epsilon chain   1AQT Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG398   cc: 88..117; sub; exp: ATPE_MYCGA MP245 302650..303051
MPN598 complement(719548..720975) atpD g1673912 D02_orf475 conf, ATP synthase beta chain   1MAB-B Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG399 MPN600 lc: 149..161; sub; exp: ATPB_MYCGA MP244 301220..302647
MPN599 complement(720975..721814) atpG g1673911 D02_orf279 conf, ATP synthase gamma chain   1NBM-G Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG400   lc: 270..278; sub; exp: ATPG_MYCGA MP243 300381..301220
MPN600 complement(721814..723370) atpA g1673910 D02_orf518 conf, ATP synthase alpha chain   1SKY-B Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG401 MPN067, MPN598   sub; exp: ATPA_MYCGA MP242 298825..300381
MPN601 complement(723373..723909) atpH g1673909 D02_orf178 conf, ATP synthase delta chain   1ABV Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG402   lc: 52..66; sub; exp: ATPD_MYCGA MP241 298286..298822
MPN602 complement(723902..724525) atpF g1673908 D02_orf207 conf, ATP synthase B chain     Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG403   sp: 1..31; tm: 50..70; cc: 73..163; sub; exp: ATPF_MYCGA ; myco's are 40 longer than all others MP240 297670..298293
MPN603 complement(724528..724845) atpE g1673907 D02_orf105 conf, ATP synthase C chain     Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG404   tm: 33..53; lc: 77..95; sub; exp: ATPL_MYCGA MP239 297350..297667
MPN604 complement(724848..725729) atpB g1673906 C12_orf293o conf, ATP synthase A chain     Energy metabolism; ATP-proton motive force interconversion; ATP + H2O = ADP + P; subunit; transporter, proton, subunit; MG405   tm: 39..59 101..121 128..148 199..219 223..243; sub; exp: ATP6_MYCGA MP238 296466..297347
MPN605 complement(725695..726168)   New identified New identified conserved hypothetical               236-237 296027..296500
MPN606 complement(726174..727544) eno g1673903 C12_orf456 conf, enolase (eno)   1PDY Energy metabolism, Glycolysis; enolase; 2-phospho-D-glycerate = phosphoenolpyruvate + H2O; MG407 MPN120 lc: 116..133; exp: Nitrosomonas europaea MP236 294651..296021
MPN607 727599..728072 pmsR g1673902 C12_orf157 conf, peptide methionine sulfoxide reductase       MG408 MPN197   not entirely clear? MP235 complement(294123..294596)
MPN608 complement(728069..728746) phoU g1673901 C12_orf225 conf, phosphate transport system regulatory protein     Transporter, ABC superfamily; phosphate transport, regulation; MG409     phoU negative pho regulator for inorganic phosphate import; exp: Enterobacter cloacae, negative regulatory protein of pho regulon MP234 293449..294126
MPN609 complement(728749..729738) pstB g1673900 C12_orf329 conf, phosphate specific     Transporter, ABC superfamily; phosphate transport, subunit; MG410 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 cc: 14..40; phospahte specific MP233 292457..293446
MPN610 complement(729723..731678) pstA g1673899 C12_orf651V conf, Psta /Pstc-like ABC transporter; phosphate specific 1-230, transporter; 231-410, hypothetical; 411-ct, transporter;   Transporter, ABC superfamily; phosphate transport, subunit; MG411 MPN057 sp: 1..41; tm: 65..85 114..134 145..165 269..289 369..389 416..436 457..477 486..506 608..628; lc: 547..559; dom 231-410 hypothetical; dom 1-230 transporter domain 1 dom 411-ct transporter domain 2 protein seems duplicated compared to others; phosphate specific? MP232 290517..292472
MPN611 complement(731678..732835) C12_orf385 g1673898 C12_orf385 new_conf, similar to phosphate binding protein Psts   1A54-A Transporter, ABC superfamily; phosphate transport, subunit; MG412   sp: 1..38; lc: 47..59; new_conf; signal sequence; story: complete phophate uptake there exp: Synechococcus PCC794: regulated by responce regulator, phosphate assimilation; exp: Enterobacter cloacae: inorganic phospahate uptake in chemotaxis; exp: Ecoli: Psts phosphate-binding with high specificity; Bairoch considers this to start shorter, instead of MPVFLKLTHTIRKV he puts a M, than everything is the same LRVARLSRL ...; note recognized yet by swissport P75184; Mikita sees here only one nucleotide overlap with MP232,] MP230 has 241 nts intergenic region. confirmed by updatee COG226, preiplasmic phosphate binding protein; MP231 289360..290517
MPN612 complement(733077..736070) C12_orf997 g1673897 C12_orf997 conserved hypothetical       MG414 MPN614, MPN613 sp: 1..22; cc: 475..504; paralog split MP228, MP229, signal sequence; exp: RNA data from ZMBH, 32 degrees, RNA-expressed; MP230 286125..289118
MPN613 complement(736185..737219) C12_orf344 g1673896 C12_orf344 conserved hypothetical       MG415 MPN612 tm: 302..322; part of paralog MP230; ?URF; exp: RNA data from ZMBH, this is hypothetical, no expression; MP229 284976..286010
MPN614 complement(737155..738159) C12_orf334 g1673895 C12_orf334 conserved hypothetical see: MP230         MPN612 sp: 1..22; part of paralog MP230, signal sequence; ?URF; exp: RNA data from ZMBH only expressed at 32 degress, RNA-expressed; MP228 284036..285040
MPN615 complement(738245..738994) hsdS g1673894 C12_orf249 conf,see: MP335         MPN089, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201   sub; family, see main representative MP335 MP227 283201..283950
MPN616 complement(739424..739822) rpsI g1673892 C12_orf132 conf, ribosomal protein S9       MG417     SUB; MP226 282373..282771
MPN617 complement(739828..740268) rplM g1673891 C12_orf146 conf, ribosomal protein L13       MG418     SUB; MP225 281927..282367
MPN618 complement(740299..742344) dnaX g1673890 C12_orf681 more__, gamma-like   1A5T   MG419; MG420 MPN007, MPN452 lc: 598..611 643..653; DNA polymerase III gamma has usually only 270aa; also domain insertion compared to MG; gamma is usually part of tau, but tau and homologs are only 440aa long ???; sub: DNA polymerase III MP224 279851..281896

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN619 complement(742353..745199) uvrA g1673889 C12_orf948L conf, excinuclease ABC subunit A       MG421 MPN685, MPN609, MPN432, MPN258, MPN194, MPN193   _neigo; sub A; exp: RNA data from ZMBH only 32 degree and very low, doubtful whether really expressed; MP223 276996..279842
MPN620 complement(745177..747696) C12_orf839 g1673888 C12_orf839 conserved hypothetical       MG422   cc: 257..288 344..373 646..672; lc: 603..618 767..783; ?maturase-like; paralog of MP246? hit to euglen; exp: RNA data from ZMBH, only 32 degree once, doubtful MP222 274499..277018
MPN621 complement(747742..749427) C12_orf561 g1673887 C12_orf561 new_conf, similar to metallo hydrolase   1BC2-A   MG423 MPN280   paralog of MP555 (metallo hydrolase (incl. sulfatases, some b-lactamases); Archaeoglobus: mRNA 3' -end processing factor; Methanobacterium thermoautotrophicum: cleavage and polyadenylation specificity factor (taken from Bos taurus); metallo hydrolase described described in Galperin ,M.Y. et al.Protein Sci 1998 Aug;7(8):1829-35; COG0595; new_add: but participation in mRNA 3'-processing appears likely and can be added. MP221 272768..274453
MPN622 complement(749432..749692) rpsO g1673886 C12_orf86 conf, ribosomal protein S15   1AB3   MG424     SUB; exp: _bacst MP220 272503..272763
MPN623 749850..751202 deaD g1673885 C12_orf450 conf, similar to ATP-dependent RNA helicase deaD   1A1V-A   MG425 MPN443   exp: _ecoli can suppress a mutation in rpsB, the gene encoding ribosomal protein S2; exp: involved inAutoaggregation of Lactobacillus reuteri MP219 complement(270993..272345)
MPN624 751224..751421 rpmB g1673884 C12_orf65 conf, ribosomal protein L28       MG426     SUB; required for sporulation by Bacillus subtilis; exp: _bacst MP218 complement(270774..270971)
MPN625 751465..751890 C12_orf141 g1673883 C12_orf141 new, osmotical inducible protein C like family; inducable by osmotic stress and by organic hydroperoxides       MG427   lc: 42..57; new; large family via pyrococcus hit; exp: _ecoli OSMOTICALLY INDUCIBLE PROTEIN C; exp: Xanthomonas campestris J. Bacteriol. 180 (10), 2636-2643 (1998);highly induced by organic hydroperoxides andweakly induced by H2O2, and not induced at all by a superoxide generator ; paralog of MP174; J. Mol. Biol. 220 (4), 959-973 (1991); MP217 complement(270305..270730)
MPN626 752025..752543 C12_orf172 g1673881 C12_orf172 conserved hypothetical       MG428       MP216 complement(269652..270170)
MPN627 complement(752540..754258) ptsI g1673880 C12_orf572 conf, PEP-dependent HPr protein kinase phosphoryltransferase (Enzyme I)   1BUK, 1ZYM-B Transporter, general PTS component; MG429   lc: 510..516 555..568; sub; exp: _mycca MP215 267937..269655
MPN628 complement(754263..755789) pgm g1673879 C12_orf508 conf, phosphoglycerate mutase   1AJA-A Energy metabolism, Glycolysis; phosphoglycerate mutase (pgm); glyceraldehyde 3-phosphate = glyceraldehyde 2-phosphate MG430     exp: Bacillus megaterium MP214 266406..267932
MPN629 complement(755782..756516) tim g1673878 C12_orf244 conf, triosephosphate isomerase   1AW1-A Energy metabolism, Glycolysis; triosephosphate isomerase (tim); glyceraldehyde 3-phosphate = dihydroxyacetone phosphate MG431     exp: Clostridium acetobutylicum MP213 265679..266413
MPN630 complement(756569..757783) yfiB g1673877 C12_orf404 conserved hypothetical       MG432 MPN657 tm: 37..57 94..114 120..140 188..208 230..250 278..298; lc: 386..401; tm, large family, also in Mp several members.. permease? exp: RNA data from ZMBH, no expression (lower than 160), this is hypothetical ! MP212 264412..265626
MPN631 757870..758766 tsf g1673876 C12_orf298 conf, elongation factor Ts   1EFU-B   MG433     exp: _spiri MP211 complement(263429..264325)
MPN632 758768..759475 pyrH g1673875 C12_orf235 conf, uridylate kinase     Purines, pyrimidines, nucleosides and nucleotides, Nucleotide and nucleoside interconversions. uridylate kinase (pyrH); ATP + UMP = ADP + UDP; MG434   lc: 43..52; exp: _ecoli MP210 complement(262720..263427)
MPN633 759578..760321 C12_orf247 g1673874 C12_orf247 conserved hypothetical see: MP207         MPN635 lc: 234..246; part of a 352aa MP paralog (MP207); ?URF; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP209 complement(261874..262617)
MPN634 760403..760948 C12_orf181o g1673873 C12_orf181o conserved hypothetical see: MP207         MPN635   part of a 352aa MP paralog (MP207) ?URF MP208 complement(261247..261792)
MPN635 761504..762562 E30_orf352 g1673872 E30_orf352 conserved hypothetical         MPN634, MPN633 lc: 218..230; duplicated within MP and split into 2 (MP208, MP209); exp: RNA data from ZMBH, no expression, this is hypothetical ! MP207 complement(259633..260691)
MPN636 762639..763193 frr g1673870 E30_orf184 conf, ribosome releasing factor       MG435   cc: 153..179; SUB; MP206 complement(259002..259556)
MPN637 763193..764380 cdsA g1673869 E30_orf395 conf, CDP-diglyceride synthetase 1-95 no hit 96-ct   Fatty acid and phospholipid metabolism; CDP-diglyceride synthetase (cdsA); CTP + phosphatidate = pyrophosphate + CDP-diacylglycerol; MG437 MPN057 sp: 1..35; tm: 77..97 115..135 148..168 178..198 201..221 241..261 308..328 360..380; hits eukaryotic phosphatidate cytidylyltransferases; integral membrane protein with >6tm (9 an notated, rat 6, Nt95aa no match) homology starts pos 150 (might be longer); exper:_drome _arath _soltu MP205 complement(257815..259002)
MPN638 764400..765527 E30_orf375 g1673868 E30_orf375 new_conf, specificity determining subunit for restriction enzyme belonging to the K family of S proteins       MG438 MPN089, MPN285 lc: 23..35; sub, 3 domains described, but boundaries not clear; annotated for MG; Koonin said before cc, latest COG version 0732 confirms S subunit for restriction enzymes MP204 complement(256668..257795)
MPN639 complement(765524..766387) E09_orf287o g1673867 E09_orf287o conserved hypothetical see: MP199         MPN012, MPN654, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..29; less; exp: RNA data from ZMBH, only 32 degrees, RNA-expressed; Bairoch: Gene start at aa5, so at MALKLR... Mikita noticed some overlap with MP204 MP203 255808..256671
MPN640 complement(766395..767297) E09_orf300 g1673866 E09_orf300 conserved hypothetical see: MP199         MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN639 sp: 1..22; lc: 177..190; less exp: RNA data from ZMBH, no expression, this is hypothetical ! MP202 254898..255800
MPN641 complement(767297..768127) E09_orf276 g1673865 E09_orf276 conserved hypothetical see: MP199         MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..29; less; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP201 254068..254898
MPN642 complement(768130..768969) E09_orf279 g1673864 E09_orf279 conserved hypothetical see: MP199         MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN641, MPN640, MPN639 sp: 1..18; lc: 21..33; less; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP200 253226..254065
MPN643 complement(768969..769877) E09_orf302 g1673863 E09_orf302 conserved hypothetical       MG440 MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN644, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 lc: 123..133; less (and so for all the homologues) because in MG it is claimed that this is a putative lipoprotein - there is no evidence for this (Sternberg thinks to of a putative lipoprotein); exp: RNA data from ZMBH only at 32 degress; Mikita did see an overlap of -80 nts with MP198 and so does new_conf Bairoch: The real start is MKKKIWNKTS ... MP199 252318..253226
MPN644 complement(769798..770649) E09_orf283b g1673862 E09_orf283b conserved hypothetical see: MP199         MPN654, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..30; less; exp: RNA data from ZMBH, no expression, this is hypothetical ! MP198 251546..252397
MPN645 complement(770652..771503) E09_orf283a g1673861 E09_orf283a conserved hypothetical see: MP199         MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639 sp: 1..25; less;exp: RNA data from ZMBH, no expression, this is hypothetical ! MP197 250692..251543
MPN646 complement(771503..772336) E09_orf277 g1673860 E09_orf277 conserved hypothetical see: MP199         MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..27; less; exp: RNA data from ZMBH, RNA-expressed; MP196 249859..250692
MPN647 complement(772359..773231) E09_orf290 g1673859 E09_orf290 conserved hypothetical see: MP199       MG439 MPN654, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..24; less; exp: RNA data from ZMBH, RNA-expressed; MP195 248964..249836
MPN648 complement(773342..773752) E09_orf136 g1673858 E09_orf136 conserved hypothetical       MG441 MPN212 sp: 1..41; further homolog in MP Y074; exp: RNA data from ZMBH only at 32 degrees, RNA-expressed; MP194 248443..248853

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN649 complement(774639..775049) E09_orf136L g1673857 E09_orf136L hypothetical see: MP199         MPN148, MPN054, MPN012, MPN011, MPN646, MPN643, MPN641, MPN639, MPN505, MPN466, MPN411, MPN369, MPN271   less;exp: RNA data from ZMBH, no expression, this is hypothetical ! MP193 247146..247556
MPN650 complement(775034..775339) E09_orf101 g1673856 E09_orf101 hypothetical see: MP199         MPN054, MPN012, MPN011, MPN654, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..22; less; exp: RNA data from ZMBH, RNA-expressed; MP192 246856..247161
MPN651 776337..777476 mtlA g1673855 E09_orf379 less, similar to mannitol-specific PRS EIIBC     transporter, PTS; sugar transport, mannitol, component IIBC;   MPN078 tm: 38..58 123..143 167..187 195..215 226..246; sub, wrong annotation, >4 tm regions according to Reizer can framshift lead to complete BC; exp: RNA data from ZMBH, no expression, this is hypothetical !MP191-192 (<-->) 997 N-term of MP191 # frame shift between 245982-246018 (2 base missing?) # Function: PTS EIIBC (C-, B-domains) MP191 complement(244719..245858)
MPN652 777463..778557 mtlD g1673854 E09_orf364 conf, mannitol-1-phosphate 5-dehyrogenase (EC 1.1.1.17) 4-341, Mannitol_dh (Pfam)   Energy metabolism, Sugars; mannitol-1-phosphate 5-dehydrogenase; D-mannitol 1-phosphate + NAD(+) = D-fructose 6-phosphate + NADH; note that MP189 and MP191 turn mannitol into mannitol1P; this enzyme turns it than into fructose 6-phosphate, direct link to glycolysis;         MP190 complement(243638..244732)
MPN653 778538..778969 mtlF g1673853 E09_orf143V conf, PTS system mannitol-specific component IIA (EIIA-MTL)   1A3A-A transporter, PTS; mannitol specific component IIA; see MP191 for component IIBC;       exp:_bacillus stearothermophilus, 96421984; Paulsen: PTS, mannitol MP189 complement(243226..243657)
MPN654 complement(779342..779731) E09_orf129 g1673851 E09_orf129 conserved hypothetical, see: MP199         MPN054, MPN012, MPN011, MPN650, MPN647, MPN646, MPN645, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271 sp: 1..33;   MP188 242464..242853
MPN655 780008..780622 E09_orf204o g1673850 E09_orf204o hypothetical see: MP141         , MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204 cc: 125..201; lc: 62..96; URF; exp: RNA data from ZMBH, RNA-expressed; MP187 complement(241573..242187)
MPN656 complement(781095..781910) K05_orf271 g1673849 K05_orf271 new_conf, similar to GTP-binding protein       MG442 MPN008, MPN568, MPN481, MPN475   new_conf Koonin: GTPase; unconnected; this is only once expressed low (345) at degrees, perhaps also hypothetical; MP186 240285..241100
MPN657 complement(781879..783084) K05_orf401 g1673848 K05_orf401 conserved hypothetical       MG443 MPN630 tm: 46..66 101..121 133..153 208..228 251..271 291..311; exp: RNA data from ZMBH, only once low (198, close to background) expression at 32, degrees, this is hypothetical ! MP185 239111..240316
MPN658 complement(783100..783459) rplS g1673847 K05_orf119 conf, ribosomal protein L19       MG444     SUB; MP184 238736..239095
MPN659 complement(783443..784075) trmD g1673846 K05_orf210 conf, tRNA (guanine-N1)-methyltransferase       MG445       MP183 238120..238752
MPN660 complement(784141..784407) rpsP g1673845 K05_orf88 conf, ribosomal protein S16       MG446     SUB; MP182 237788..238054
MPN661 complement(784489..786138) K05_orf499 g1673844 K05_orf499 conserved hypothetical       MG447   tm: 58..78 96..116 183..203 210..230 252..272 303..323 349..369 388..408 420..440 451..471; exp: RNA data from ZMBH, at 32 degrees 2x; RNA-expressed; MP181 236207..237706
MPN662 complement(786139..786594) pilB g1673843 K05_orf151 conserved hypothetical       MG448     similar to the c-term. non catalytic part of sulfoxide reductases don't know, what pilB means exp: RNA data from ZMBH, RNA-expressed; MP180 235601..236056
MPN663 complement(786558..787262) K05_orf234 g1673842 K05_orf234 conserved hypothetical   1PYS-B   MG449 MPN106   similar to a part of tRNA-synthetase probably nucleic-binding exp: RNA data from ZMBH, RNA-expressed; MP179 234933..235637
MPN664 complement(787269..787982) degV g1673841 K05_orf237 conserved hypothetical       MG450 MPN472 lc: 163..181; exp: RNA data from ZMBH, RNA-expressed; MP178 234213..234926
MPN665 complement(788141..789325) tuf g1673840 K05_orf394 conf, elongation factor TU   1EFT   MG451 MPN279, MPN227, MPN155 lc: 222..236; sub: translation MP177 232870..234054
MPN666 789410..790165 K05_orf251 g1673838 K05_orf251 conserved hypothetical       MG452 MPN274 sp: 1..38; tm: 85..105 120..140 156..176 206..226; exp: RNA data from ZMBH shows no expression, this is hypothetical ! MP176 complement(232030..232785)
MPN667 790153..791028 gtaB g1673837 K05_orf291 conf, UDP-glucose pyrophosphorylase     Purines, pyrimidines, nucleosides and nucleotides, Sugar-nucleotide biosynthesis and conversions; UDP-glucose pyrophosphorylase; UTP + Glucose 1-Phosphate = PPi + UDP-Glucose MG453       MP175 complement(231167..232042)
MPN668 complement(791025..791447) osmC g1673836 K05_orf140 conserved hypothetical       MG454     gb-entry tells nothing about the function MP174 230748..231170
MPN669 791473..792672 tyrS g1673835 K05_orf399 conf, tyrosyl tRNA synthetase   1TYA-E   MG455   lc: 281..293;   MP173 complement(229523..230722)
MPN670 complement(792712..793749) K05_orf345 g1673834 K05_orf345 conserved hypothetical       MG456   sp: 1..41; tm: 52..72; lc: 312..331; exp: RNA data from ZMBH, RNA-expressed; MP172 228446..229483
MPN671 complement(794302..796431) ftsH g1673833 K05_orf709 conf, cell division protein FtsH   1D2N-A   MG457 MPN536 sp: 1..42; tm: 173..193; cc: 672..702; lc: 641..656;   MP171 225764..227893
MPN672 complement(796612..797139) hpt g1673832 K05_orf175 conf, hypoxanthine-guanine phosphoribosyltransferase   1HGX-B Nucleotide and deoxynucleotide degradation or rescue reaction. hypoxanthine-guanine phosphoribosyltransferase; Inosine monophosphate + pyrrophosphate = hypoxanthine + phosphoribosylpyrrophospate; note: Guanine and 6-mercaptopurine can replace hypoxanthine; MG458       MP170 225056..225583
MPN673 complement(797139..797648) K05_orf169 g1673831 K05_orf169 conserved hypothetical       MG459 MPN041   exp: RNA data from ZMBH, RNA-expressed; MP169 224547..225056
MPN674 797819..798757 ldh g1673830 K05_orf312 conf, L-lactate dehydrogenase   2LDX Energy metabolism, Aerobic; L-lactate dehydrogenase (ldh); lactate + NAD = pyruvate + NADH; MG460   sp: 1..21; homotetramer MP168 complement(223438..224376)
MPN675 complement(799162..799467) K05_orf101a g1673829 K05_orf101a hypothetical see: MP141         MPN151, MPN145, MPN139, MPN137, MPN127, MPN038, MPN010, MPN504, MPN484, MPN344, MPN287   exp: RNA data from ZMBH, RNA-expressed; MP167 222728..223033
MPN676 799858..800178 K05_orf106 g1673828 K05_orf106 hypothetical see: MP376         MPN037, MPN465 lc: 7..21; MP specific exp: RNA data from ZMBH, RNA-expressed; MP166 complement(222017..222337)
MPN677 complement(800735..802012) K05_orf425 g1673826 K05_orf425 new_conf, similar to ATPases       MG461     new_conf Koonin zn-dependent protease; unconnected MP165 220183..221460
MPN678 complement(801993..803447) gltX g1673825 K05_orf484 conf, glutamyl-tRNA synthetase   1GLN   MG462   cc: 388..414;   MP164 218748..220202

MPN Position Gene GI Orf Annotation Domain Structure Pathway MG Ortholog MP Homolog Intrinsics Comments MP_old MP_old_Position
MPN679 complement(803434..804225) ksgA g1673824 K05_orf263V conf, S-adenosylmethionine-6-N',N'-adenosyl(rRNA) dimethyltransferase   1YUB   MG463       MP163 217970..218761
MPN680 complement(804218..805375) K05_orf385 g1673823 K05_orf385 conserved hypothetical       MG464   tm: 45..65 116..136 150..170 220..240 270..290 324..344; exp: RNA-HP, but only at 32 degrees 2x; RNA-expressed; MP162 216820..217977
MPN681 complement(805356..805712) rnpA g1673822 K05_orf118V conf, RNaseP C5 chain 161 3-110, Ribonuclease_P (Pfam)     MG465     exp:_ecoli, 86056995 MP161 216483..216839
MPN682 complement(805702..805848) rpmH g1673821 K05_orf48 conf, ribosomal protein L34       MG466     SUB; MP160 216347..216493
MPN683 complement(805871..806890) devA g1673820 K05_orf339 new_conf, ABC transporter subunit 143-327, ABC_tran (Pfam)     MG467 MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193 lc: 41..83; sub new_conf, Koonin; similar to ABC-transporter similar to ABC-transporter (only ATP-binding subunit) Paulsen: ABC transporter MP159 215305..216324
MPN684 complement(806892..812540) K05_orf1882 g1673819 K05_orf1882 conserved hypothetical, suggestion: membrane transporter component       MG468 MPN080 sp: 1..37; tm: 987..1007 1037..1057 1082..1102 1154..1174 1759..1779 1802..1822 1825..1845 1848..1868; lc: 106..119 222..236 298..312 351..368 486..499 662..701 1576..1599; as I (thomas) suggested tentatively for MP075 and perhaps suggested here by the gene neighbourhood to MP157 and MP159 this may again be a membrane transporter component, loconf,also at the intrinsic features; exp: RNA data from ZMBH, 2D-Gel Ges.; auf Gel 141 Bruchstueck bei ca. 30kD, IEP ca. 4.7 RNA-expressed; MP158