Genome Re-Annotation for M. pneumoniae: The complete annotation table

The NAR publication of this work.

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN029	33979..34551	efp	g1673784	B01_orf190	conf, elongation factor P		1BKB		MG026			sub: translation;	MP125	complement(171250..171822)
MPN030	34469..34975	B01_orf168	g1673783	B01_orf168	conserved hypothetical				MG027		sp: 1..20;		MP124	complement(170826..171332)
MPN031	34975..35586	B01_orf203	g1673782	B01_orf203	conserved hypothetical				MG028		sp: 1..29; tm: 42..62 86..106 127..147;	exp: RNA data from ZMBH, but only once at 32 degree, remain sceptical.	MP123	complement(170215..170826)
MPN032	complement(35810..36136)	B01_orf108	g1673781	B01_orf108	new_conf, hydrolase		1IPH-A		MG029			new_conf, similar to other hydrolases exp:_pyrfu; exp: RNA data from ZMBH, RNA-expressed; latest versioin of COG693 suggsests a protease/amidase; hydrolase is meant as being less specific on the function, protease is not sure by the sequence evidence, but plausible.	MP122	169665..169991
MPN033	complement(36140..36760)	upp	g1673780	B01_orf178	conf, uracil phosphoribosyltransferase			Purines, pyrimidines, nucleosides and nucleotides; Salvage of nucleosides and nucleotides; uracil phosphoribosyltransferase; UMP + pyrrophosphatete = Uracile + phosphoribosylpyrrophosphate..	MG030	MPN073	tm: 96..116;	new compared to Bairoch: In P75081 still considered to start at MALSQITSLL ...; but now updated, 15.2.2000;	MP121	169125..169661
MPN034	complement(36800..41131)	polC	g1673778	B01_orf1443	conf, DNA polymerase III (dnaE) alpha chain				MG031	MPN378		sub: DNA polymerase III;	MP120	164670..169001
MPN035	41409..43409	B01_orf666	g1673777	B01_orf666	conserved hypothetical see: MP118					MPN049, MPN048, MPN042, MPN041, MPN039, MPN036, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234	sp: 1..22; cc: 323..371;	exp: No expression (3 measurements), is not expressed !	MP119	complement(162392..164392)
MPN036	43581..45602	B01_orf673	g1673776	B01_orf673	conserved hypothetical				MG032	MPN049, MPN048, MPN042, MPN041, MPN039, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234	sp: 1..30; cc: 313..376; lc: 130..143;	exp: RNA data from ZMBH, RNA-expressed;	MP118	complement(160199..162220)
MPN037	45770..46213	B01_orf147	g1673775	B01_orf147	hypothetical see: MP376					MPN676, MPN465	tm: 11..31 40..60 75..95; lc: 133..145;	MP specific exp: RNA data from ZMBH, RNA-expressed;	MP117	complement(159588..160031)
MPN038	complement(46442..46792)	B01_orf116L	g1673774	B01_orf116L	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URF exp: RNA data from ZMBH, RNA-expressed;	MP116	159009..159359
MPN039	47194..48210	B01_orf338	g1673773	B01_orf338	conserved hypothetical see: MP118					MPN049, MPN048, MPN042, MPN036, MPN035, MPN512, MPN510, MPN509, MPN508, MPN234	sp: 1..23;	exp: RNA data from ZMBH, RNA-expressed;	MP115	complement(157591..158607)
MPN040	complement(48105..48416)	B01_orf103b	g1673772	B01_orf103b	conserved hypothetical						sp: 1..45; lc: 46..75;	URF exp: RNA data from ZMBH, RNA-expressed;	MP114	157385..157696
MPN041	48670..49230	B01_orf186L	g1673771	B01_orf186L	conserved hypothetical see: MP118					MPN049, MPN048, MPN042, MPN036, MPN035, MPN673, MPN511, MPN510, MPN509, MPN508		exp: RNA data from ZMBH, RNA-expressed;	MP113	complement(156571..157131)
MPN042	49292..51310	B01_orf672	g1673769	B01_orf672	conserved hypothetical see: MP118					MPN049, MPN048, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234	sp: 1..28; cc: 102..125 319..366;	exp: RNA data from ZMBH, RNA-expressed;	MP112	complement(154491..156509)
MPN043	51634..52428	glpF	g1673768	B01_orf264	conf, glycerol uptake facilitator			transporter, ion channels; note that this can also transport e.g. urea and polyols;	MG033		tm: 13..33 49..69 102..122 165..185 193..213;	Paulsen: Ion channel, MIP, glycerol	MP111	complement(153373..154167)
MPN044	complement(52475..53050)	tdk	g1673767	B01_orf191	conf, thymidine kinase			Purines, pyrimidines, nucleosides and nucleotides; Salvage of nucleosides and nucleotides; thymidine kinase; ATP + thymidine = ADP + thymidine5Phosphate.	MG034			exp: 2D-Gel data from ZMBH Ges., MW 24kD, IEP ca. 8.9	MP110	152751..153326
MPN045	53077..54321	hisS	g1673766	B01_orf414o	conf, histidyl-tRNA synthetase		1HTT-A		MG035		lc: 232..247;	homodimer; translation	MP109	complement(151480..152724)
MPN046	54293..55966	aspS	g1673765	D09_orf557	conf, aspartyl-tRNA synthetase		1ASY-A		MG036	MPN277, MPN252, MPN214			MP108	complement(149835..151508)
MPN047	55942..57297	D09_orf451	g1673764	D09_orf451	new_conf, similar to nicotinate phosphoribosyl transferase			cofactor metabolism; nicotinate + 5-PRPP = nicotinate-ribonucleotide + PPi	MG037			new_conf; however, just sequence similarity; similar to NICOTINATE PHOSPHORIBOSYLTRANSFERASE;would also explain how NAD is created in MP, as there is only nicotinate imported; seems more likely than the horizontal transfer story of a pre-B-cell factor; psi blast search from the putative human factor converges and finds only homologues from SY and MP,MG; the paper reports only ill chracterized factor; on the other hand psi-blast search with MP107 brings within 2 iterations whole family up and several times relation to nicotinate phosphoribosyl transferases; described also in updated COG1488	MP107	complement(148504..149859)
MPN048	57886..59442	D09_orf518	g1673763	D09_orf518	new, membrane export protein family see: MP334					MPN049, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234	cc: 201..251;	putative, see MP334	MP106	complement(146359..147915)
MPN049	59619..61517	D09_orf632	g1673761	D09_orf632	new, membrane export protein family see: MP334				MG096	MPN048, MPN042, MPN041, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508, MPN234	sp: 1..28; cc: 317..372;	putative, see MP334	MP105	complement(144284..146182)
MPN050	complement(61977..63503)	glpK	g1673760	D09_orf508	conf, glycerol kinase		1BU6-O	Central intermediary metabolism, Other; glycerol kinase (glpK); glycerol + ATP = ADP + glycerol 3-phosphate;	MG038			exp: 2D-Gel data from ZMBH Ges.	MP104	142298..143824
MPN051	complement(63494..64648)	glpD	g1673759	D09_orf384	less, glycerol-3-phospate dehydrogenase		1AA8-A	Energy metabolism, Aerobic; aerobic glycerol-3-phospate dehydrogenase (GLPD); Sn-glycerol 3-phosphate+ NAD = glycerone phosphate + NADH ;	MG039			less:glycerol-3-phospate dehydrogenase exp: 2D-Gel data from ZMBH Ges.	MP103	141153..142307
MPN052	64831..66804	D09_orf657	g1673758	D09_orf657	conf, putative lipoprotein, MG040 homolog, from M. genitalium				MG040		sp: 1..20; lc: 258..270;	exp: 2D-Gel data from ZMBH, TX-UF, Ges.; Gel96+258 ca. 8kD c-term. Stueck, Gel140+157 22kD Bruchst. aus Mitte, IEP ca. 9.8	MP102	complement(138997..140970)
MPN053	66822..67088	ptsH	g1673757	D09_orf88	conf, phosphocarrier protein HPr		1PCH	transporter, general PTS system component;	MG041			N-term-seq MKKIGVVKD as predictes; expressed as protein; 2D-Gel data from ZMBH, Ges., Cytosol;	MP101	complement(138713..138979)
MPN054	68627..68998	D09_orf123	g1673756	D09_orf123	conserved hypothetical see: MP199					MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN645, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN411, MPN369, MPN271	sp: 1..22;	less	MP100	complement(136803..137174)
MPN055	70404..72086	potA	g1673754	D09_orf560L	conf, spermidine/putrescine transport ATP-binding prot			Transporter, ABC superfamily; polyamine transport	MG042	MPN134, MPN081, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193	cc: 148..223;		MP099	complement(133715..135397)
MPN056	72088..72948	potB	g1673753	D09_orf286b	conf, spermidine/putrescine transport system permease			Transporter, ABC superfamily; polyamine transport	MG043	MPN057	sp: 1..32; tm: 64..84 93..113 138..158 193..213 248..268; lc: 114..126;		MP098	complement(132853..133713)
MPN057	72941..73801	potI	g1673752	D09_orf286a	conf, spermidine/putrescine transport system permease			Transporter, ABC superfamily; polyamine transport	MG044	MPN056, MPN637, MPN610	sp: 1..40; tm: 78..98 121..141 144..164 195..215 246..266;		MP097	complement(132000..132860)
MPN058	73786..75243	D09_orf485	g1673751	D09_orf485	conserved hypothetical				MG045		sp: 1..23; lc: 391..415 423..439;	less, unknown function; suggestion STRING-server: periplasmic binding, ABC transporter;	MP096	complement(130558..132015)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN059	75243..76202	gcp	g1673750	D09_orf319	conf, o-sialoglycoprotein endopeptidase				MG046				MP095	complement(129599..130558)
MPN060	76186..77337	metX	g1673749	D09_orf383	conf, S-adenosylmethionine synthetase 2		1FUG-A		MG047				MP094	complement(128464..129615)
MPN061	complement(77625..78977)	ffh	g1673748	D09_orf450	conf, signal recognition particle protein		1FFH		MG048	MPN425			MP093	126824..128176
MPN062	79033..79749	deoD	g1673747	D09_orf238	conf, purine-nucleoside phosphorylase		1A69-A	Purines, pyrimidines, nucleosides and nucleotides, Salvage of nucleosides and nucleotides; purine-nucleoside phosphorylase; Purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate; in addition it can transfer ribose from one base to another base; note that MP089 - MP092 all could work together, operon like;	MG049			exp: N-term-seq MTPHINAKKD as predicted; expressed as a protein;	MP092	complement(126052..126768)
MPN063	79753..80427	deoC	g1673746	D09_orf224	conf, deoxyribose-phosphate aldolase			Energy metabolism, Sugars. deoxyribose-phosphate aldolase (deoC); 2-deoxy-D-ribose 5-phosphate = D-glyceraldehyde 3-phosphate + acetaldehyde;	MG050			exp: 2D-Gel data from ZMBH, Ges., IEP 8.9;	MP091	complement(125374..126048)
MPN064	80414..81679	deoA	g1673745	D09_orf421	conf, thymidine phosphorylase		1TPT	Purines, pyrimidines, nucleosides and nucleotides, purine ribonucleotide biosynthesis; thymidine phosphorylase; Thymidine + Phosphate = Thymin + deoxyribose 1-phosphate.	MG051				MP090	complement(124122..125387)
MPN065	81690..82091	cdd	g1673744	D09_orf133	conf, cytidine deaminase		1AF2-A	Purines, pyrimidines, nucleosides and nucleotides, purine ribonucleotide biosynthesis;cytidine deaminase; Cytidine + H2O = uracile + NH3.	MG052			exp: 2D-Gel data from ZMBH, Ges.	MP089	complement(123710..124111)
MPN066	82081..83745	cpsG	g1673743	D09_orf554	less, two functions are possible, as both enzymes are homologous to each other: phosphomannomutase or phosphoglucomutase		1JDY-A	Energy metabolism, Sugars; phosphomannomutase (cpsG); D-mannose 1-phosphate = D-mannose 6-phosphate; phosphoglucomutase; D-glucose 1-phosphate = D-glucose 6-phosphate;	MG053			less; second enzyme is homolgous; looking at the pathway, the isolated mannose activity makes not too much sense; the phosphoglucomutase seems to fit better;	MP088	complement(122056..123720)
MPN067	complement(83713..84675)	nusG	g1673742	D09_orf320	conf, transcription antitermination factor				MG054			exp: expressed as protein; N-term-seq MEQVELIPQT as predicted;	MP087	121126..122088
MPN068	complement(84683..85060)	D09_orf125	g1673741	D09_orf125	new_conf, SecE				MG055		tm: 91..111;	new_conf Koonin COG; SecE Protein Transport system; -----qvcebrhujgpolinx [N] COG0690 Preprotein translocase subunit SecE	MP086	120741..121118
MPN069	complement(85066..85212)		New identified	New identified	ribosomal protein L33								085-086	120589..120735
MPN070	complement(85228..85611)	D09_orf127a	g1673739	D09_orf127a	conf, D09_orf127a Protein				MG055.2		sp: 1..27; tm: 56..76;		MP085	120190..120573
MPN071	complement(85598..86428)	yabC	g1673738	D09_orf276	hypothetical protein (yabC) homolog; similar to Swiss-Prot Accession Number P37544, from B. subtilis				MG056			exp: RNA data from ZMBH, only at 32 degrees (twice), RNA-expressed;	MP084	119373..120203
MPN072	complement(86410..86946)	yabF	g1673737	D09_orf178	new_conf, similar to nucelotidyl transferase/polynicleotide cleavage				MG057		1-100 Toprim domain;	exp: RNA data from ZMBH, RNA-expressed; sequence annotation or this protein by Aravind in pubmed PMID: 9722641, UI: 98391745; new_conf koonin;	MP083	118855..119391
MPN073	complement(86925..88091)	prs	g1673736	D09_orf388	conf, phosphoribosylpyrophosphate synthetase		1OPR	Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis; phosphoribosylpyrophosphate synthetase (prs); ATP + Ribose5Phosphate = PhosphoRibosylPyrroPhosphate + AMP.	MG058	MPN033, MPN395		Mikita noticed here an overlap of 194 nts with MP081; new_conf Bairoch swissprot P75044 considers that this protein starts in fact really at MGLITHNEFA, so later	MP082	117710..118876
MPN074	complement(87898..88341)	D09_orf147	g1673735	D09_orf147	hypothetical protein (A43259) homolog; similar to GenBank Accession Number A43259, from E. hirae				MG059			exp: RNA data from ZMBH, RNA-expressed;	MP081	117460..117903
MPN075	88348..89247	ywdF	g1673734	D09_orf299	new_conf, Glycosyl Transferase				MG060	MPN028		new_conf pfam; Pfam:Glycos_transf_2 (4-170); exp: RNA data from ZMBH, RNA-expressed;	MP080	complement(116554..117453)
MPN076	complement(89299..90993)	uhpT	g1673733	R02_orf564o	HYPOTHETICAL PROTEIN				MG061	MPN077	sp: 1..25; tm: 87..107 168..188 221..241 249..269 306..326 361..381 391..411 415..435 455..475 503..523;	less; HYPOTHETICAL PROTEIN; exp: RNA data from ZMBH, RNA-expressed;	MP079	114808..116502
MPN077	complement(91199..92839)	R02_orf469	g1673732	R02_orf469	hypothetical, see: MP079					MPN076	sp: 1..28; tm: 110..130 143..163 171..191 224..244 267..287 300..320 323..343 362..382 403..423; lc: 55..72;		MP078	113193..114602
Ser-tRNA(AGC)	complement(93052..93140)	mptgsb											complement(93052..93140)	112661..112749
MPN078	93191..95275	fruA	g1673731	R02_orf694	conf, fructose-permease IIBC component		1A6J-A	transporter, PTS; for fructose; note just besides 1-phosphofructokinase MP076, MP077 generates fuctose 1-phosphate during transport;	MG062	MPN651, MPN575	tm: 318..338 365..385 422..442 461..481 500..520 544..564 577..597 605..625 656..676;		MP077	complement(110526..112610)
MPN079	95268..96170	fruK	g1673730	R02_orf300	conf, 1-phosphofructokinase		1RKD	Energy metabolism, Glycolysis; 1-phosphofructokinase (fruK); fructose 1-phosphate + ATP = fructose 1,6-biphosphate; note that this immediately turns the fructose 1-phosphate generated by transport from MP067 into glycolysis;	MG063		lc: 162..171;	exp: 2D-Gel data from ZMBH, Ges., ca. 36kD;	MP076	complement(109631..110533)
MPN080	96407..100567	R02_orf1386V	g1673728	R02_orf1386V	new, Probably ABC transporter membrane protein subunit			Transporter, ABC superfamily; probably membrane subunit for MP074;	MG064	MPN684	sp: 1..31; tm: 517..537 561..581 606..626 682..702 1259..1279 1301..1321 1349..1369; lc: 286..303;	blast finds at 0.0037 part of the ABC transporter membrane protein and we have the TM regions (see intrinsics), furthermore MP074 requires its other component one could tentatively suggest this. Q 505-597; S359-450; Streptococcus mutans ABC transporter; (higher 4 blast values only for hypothetical proteins); no COG,Koonin; no Sternberg (1.3.00);	MP075	complement(105234..109394)
MPN081	100567..101964	glnQ	g1673727	R02_orf465	conf, glutamine transport ATP-binding protein			Transporter, ABC superfamily; transports glutamine, perhaps more aminoacids;	MG065	MPN134, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193			MP074	complement(103837..105234)
MPN082	101985..103931	tklB	g1673726	R02_orf648	conf, transketolase 1		1AY0-A	Energy metabolism, Pentose Phosphate pathway; transketolase 1; Sedoheptulose 7-phosphate + D-glyceraldehyde 3-phosphate = D-ribose 5-phosphate + D-xylulose 5-phosphate note: Thiamin pyrophosphate cofactor Wide specificity for both reactants, e.g. converts hydroxypyruvate and R-CHO into CO(2) and R-CHOH-CO-CH(2)OH.Transketolase e.g.from Alcaligenes faecalis shows high activity with D-erythrose as acceptor. This enzyme could fill up several gaps in PPP.	MG066	MPN393	lc: 545..559;	exp: 2D-Gel data from ZMBH, Ges.,	MP073	complement(101870..103816)
MPN083	103941..105542	R02_orf533	g1673725	R02_orf533	only a conserved hypothetical,MG067 homolog, from M. genitalium				MG067	MPN084, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577	sp: 1..24;	less; HYPOTHETICAL PROTEIN,	MP072	complement(100259..101860)
MPN084	105592..107166	R02_orf524	g1673724	R02_orf524	conserved hypothetical, see: MP072				MG068	MPN083, MPN592, MPN591, MPN590, MPN589, MPN588, MPN587, MPN586, MPN585, MPN584, MPN583, MPN582, MPN581, MPN580, MPN577	sp: 1..22;		MP071	complement(98635..100209)
MPN085	107273..108595	R02_orf440	g1673723	R02_orf440	new, adhesin P1 (group2) homolog; see: MP025					MPN129, MPN090, MPN087, MPN086, MPN593	sp: 1..45; tm: 56..76 95..115 138..158 209..229 245..265 268..288 392..412; cc: 116..137;	via homology to MP025	MP070	complement(97206..98528)
MPN086	108857..109174	R02_orf105	g1673722	R02_orf105	new, adhesin P1 (group2) homolog; see: MP025					MPN085, MPN435	sp: 1..45; tm: 64..84;	via homology to MP070	MP069	complement(96627..96944)
MPN087	109346..109798	R02_orf150	g1673721	R02_orf150	new, adhesin P1 (group2) homolog; see: MP025					MPN085	tm: 43..63 85..105 124..144;	via homology to MP070	MP068	complement(96003..96455)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN088	110813..111118	R02_orf101	g1673718	R02_orf101	conf, R02_orf101 Protein								MP067	complement(94683..94988)
MPN089	111610..112617	hsdS	g1673717	R02_orf335	conf, see: MP335					MPN638, MPN615, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285, MPN201	lc: 105..126;	family, see main representative MP335	MP066	complement(93184..94191)
MPN090	112772..113761	R02_orf329	g1673716	R02_orf329	new, adhesin P1 (group2) homolog; see: MP025					MPN129, MPN085	sp: 1..43; tm: 78..98 163..183 218..238 265..285 299..319; lc: 193..209;	via homology to MP025	MP065	complement(92040..93029)
MPN091	113838..114254	R02_orf138	g1673715	A05_orf139	conserved hypothetical,see: MP378					MPN115, MPN463			MP064	complement(91547..91963)
MPN092	114572..115093	R02_orf173	g1673714	R02_orf173	new_conf, involved in cytadherence,see: MP012					MPN149, MPN142, MPN102, MPN503, MPN464, MPN414, MPN367		exp: RNA data from ZMBH, RNA-expressed;	MP062	complement(90708..91229)
MPN093	114948..115853	R02_orf301	g1673713	R02_orf301	new_conf, involved in cytadherence, see: MP012					MPN150, MPN142, MPN102, MPN503, MPN464, MPN414, MPN367	lc: 49..62;	exp: RNA data from ZMBH, RNA-expressed;	MP061	complement(89948..90853)
MPN094	116287..116709	R02_orf140	g1673712	R02_orf140	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 116..139;	URF; exp: RNA data from ZMBH, RNA-expressed;	MP060	complement(89092..89514)
16S_rRNA	118312..119824	No info			The region is selected according to Database of Small Subunit of rRNA and Genbank(acc:M29061). In the ssu DB, 3'-48 more residues to M29061 are expected by alignment of closely related species, so I extended the 48 residue to the region that is coverd by M29061. M29061 lacks 5'-TCA and 3'-56 residues comparing to ZMBH www page. There are 5 mismatchs between the selected region in the genome sequence and M29061 (4 out of 5 is 'N' in M29061).								118312..119824	complement(85977..87489)
23S_rRNA	120057..122961	No info			The region is selected according to Database of Large Subunit of rRNA and Genbank(acc:X68422). X68422 lacks 5'-A but more 3'-179 residues comparing to ZMBH www page.								120057..122961	complement(82840..85744)
5S_rRNA	122999..123106	No info			no 5S rRNA in Genbank. The region is selected according to the 5S rRNA DB (rose.man.poznan.pl/5SData). In ZMBH www page, 5'-TTTGG is missing.								122999..123106	complement(82695..82802)
MPN095	123290..124054	R02_orf254	g1673710	R02_orf254	new_conf, aa_permeases see: MP058			Transporters, probably APC family like; amino acid permease		MPN308	sp: 1..33; tm: 53..73 105..125 145..165 179..199 213..233;	new_conf; Homology with Nterm of MP528 (aa_permeases) join MP059 MP058 = MP528 Pfam:aa_permeases (Evalue - 0.64) See aligment. Also confirmed by COG0531	MP059	complement(81747..82511)
MPN096	124054..124848	R02_orf264	g1673709	R02_orf264	new_conf, aa_permeases			Transporters, probably APC family like; amino acid permease		MPN308	sp: 1..20; tm: 40..60 101..121 147..167 179..199 216..236;	new_conf; Homology with Cterm of MP528 (aa_permeases) join MP059 MP058 = MP528 Pfam:aa_permeases (Evalue - 0.64) See aligment. Also confirmed by COG0531	MP058	complement(80953..81747)
MPN097	125024..126649	R02_orf541	g1673708	R02_orf541	conserved hypothetical see: MP631					MPN152, MPN147, MPN146, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199	sp: 1..27; lc: 39..52 224..238 406..418 448..460;	see comments to MP631.	MP057	complement(79152..80777)
MPN098	126947..127390	R02_orf147	g1673707	R02_orf147	conserved hypothetical see: MP631					MPN152, MPN147, MPN506, MPN408, MPN364, MPN288, MPN284, MPN282, MPN200, MPN199		see comments to MP631.	MP056	complement(78411..78854)
MPN099	128076..129119	R02_orf347L	g1673706	R02_orf347L	conf, see: MP013					MPN144, MPN141, MPN132, MPN500, MPN409, MPN370, MPN286, MPN203, MPN202	lc: 189..209 306..327;		MP055	complement(76682..77725)
MPN100	129458..130009	R02_orf183o	g1673705	R02_orf183o	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 116..142;	exp: RNA data from ZMBH, RNA-expressed;	MP054	complement(75792..76343)
MPN101	130466..131752	C09_orf428V	g1673703	C09_orf428V	conf, see: MP013					MPN141, MPN128, MPN502, MPN462, MPN370, MPN205	lc: 131..140 170..190 249..268 366..378;		MP053	complement(74049..75335)
MPN102	132568..133386	C09_orf272	g1673702	C09_orf272	new_conf, involved in cytadherence, see: MP012					MPN150, MPN149, MPN142, MPN093, MPN092, MPN503, MPN464, MPN414, MPN367	lc: 13..28;	exp: RNA data from ZMBH, at 32 degrees, only once; RNA-expressed ?	MP052	complement(72415..73233)
MPN103	complement(134055..134573)	C09_orf172	g1673701	C09_orf172	conf, C09_orf172 Protein					MPN037, MPN465	tm: 26..46;		MP051	71228..71746
MPN104	134583..134897	C09_orf104	g1673700	C09_orf104	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URF; exp: RNA data from ZMBH, high at 32 and 37, RNA-expressed;	MP050	complement(70904..71218)
MPN105	135731..136756	pheS	g1673699	C09_orf341	conf, phenylalanyl-tRNA synthetase alpha-subunit		1PYS-A, 1PYS-B, 1ASY-A		MG194				MP049	complement(69045..70070)
MPN106	136759..139176	pheT	g1673698	C09_orf805	conf, phenylalanyl-tRNA synthetase beta chain		1PYS-B		MG195	MPN663			MP048	complement(66625..69042)
MPN107	139289..140044	C09_orf251	g1673697	C09_orf251	conserved hypothetical protein						lc: 186..196;	Lactococcus lactis Region new_add; similarity Lactococcus lactis(sptrembl:O53069) Funtional annotation of Lactococcus lactis proteins is probably wrong; exp: RNA data from ZMBH, 32 degrees (twice), RNA-expressed;	MP047	complement(65757..66512)
MPN108	140046..141260	C09_orf404	g1673696	C09_orf404	conserved hypothetical, see: MP043					MPN111	lc: 262..276;	Lactococcus lactis Region new_add; similarity C-ter (843-1268) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong.	MP046	complement(64541..65755)
MPN109	141940..142437	C09_orf165	g1673694	C09_orf165	conf, C09_orf165 Protein						cc: 71..98;	2d-Gel-PH Ges.	MP045	complement(63364..63861)
MPN110	142361..144517	C09_orf718	g1673693	C09_orf718	conserved hypothetical protein						lc: 581..598;	Lactococcus lactis Region new_add; similarity N-ter (293-701) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. exp: RNA data from ZMBH, both at 32 and 37 degrees; RNA-expressed	MP044	complement(61284..63440)
MPN111	145021..146289	C09_orf422	g1673692	C09_orf422	conserved hypothetical protein					MPN108		Lactococcus lactis Region new_add; similarity C-ter (843-1268) of Lactococcus lactis(trembl:LLCPJW565_3) Funtional annotation of Lactococcus lactis proteins is probably wrong. exp: RNA data from ZMBH, but only once at 32 degree seen with low expression (below 150 not sure above background): Really doubtful / URF	MP043	complement(59512..60780)
MPN112	147149..147541	C09_orf130b	g1673691	C09_orf130b	new_conf, permease					MPN421	tm: 32..52 71..91 101..121;	via homology to MP420; also COG0477;	MP042	complement(58260..58652)
MPN113	148090..148761	C09_orf223	g1673690	C09_orf223	new, Similarity to G3P transporters					MPN421	tm: 28..48 60..80 91..111 174..194;	new; Join MP42 MP41 Similarity with G3P transporters	MP041	complement(57040..57711)
MPN114	148751..150553	cpt2	g1673689	C09_orf600	more__, Acyltransferase			Fatty acid and phospholipid metabolism; carnitine acyltransferase; acylCoA + carnitin = CoA + acylcarnitine; transporter, membrane carrier;			lc: 129..141;	new_add; Horizontal Transfer less; Acyltransferase Probably Carnitine dependent	MP040	complement(55248..57050)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN115	150643..151248	infC	g1673688	C09_orf201	conf, translation initiation factor IF3		2IFE, 1TIF		MG196				MP039	complement(54553..55158)
MPN116	151254..151433	rpmI	g1673687	C09_orf59	conf, ribosomal protein L35				MG197			SUB; SUB ribosomal; annot full length true (psi-blast);	MP038	complement(54368..54547)
MPN117	151444..151827	rpLT	g1673686	C09_orf127	conf, ribosomal protein L20				MG198			SUB;	MP037	complement(53974..54357)
MPN118	complement(151802..152512)	C09_orf143b	g1673685	C09_orf143b	new_conf, Similarity with Ribonuclease HII				MG199		lc: 71..84;	new_conf; Dr.M.Itaya Similarity with Ribonuclease HII; to be more exact, with rnhC from B.subtilis (J.Bacteriol 181, 2118-2123; in psi-blast one finds only that it is an RNAseH II / rnhB, but the direct investigation in B.sub indicates more rnhC as far as B.sub co9ncerned; essential gene; Mikitas extension gives a much more sensible weight of 23.6 kDa; B.sub has 33.9; RNA data from ZMBH, exp: the gene is well expressed. Question: Is there confirmatory size estimate by Northern available (or even by two different oligos to show that N-terminal extension IS expressed) ? (N-terminal sequencing is even better); Bairoch: protein starts at the old start P75446 swissnew	MP036	53568..53999
MPN119	152568..155300	C09_orf910	g1673683	C09_orf910	less, contains j-domain of DnaJ; and a domain common to cytadherence proteins	1-77 similar to j-domain of DnaJ; 233-259 domain present only in MP/MG	1HDJ	cochaperon (?) possible activation of DnaK	MG200	MPN021, MPN002, MPN567, MPN447, MPN391	lc: 109..120 268..284;	unconnected; contains a domain repeated in DNJM/P200/HMV1 of both MP/MG (cytadherence related proteins); story: possible link between cell surface and chaperon activity; not a DnaJ but likely to activate DnaK as it contains a j-domain of DnaJ; exp: 94149015 _ECOLI	MP035	complement(50501..53233)
MPN120	155323..155976	grpE	g1673682	C09_orf217	conf, heat shock protein GrpE		1DKG-A	chaperon	MG201		cc: 23..104;	sub:hsp70 with DnaJ, MP133 and DnaK MP407 2D-Gel data from ZMBH, Ges., IEP 8.2	MP034	complement(49825..50478)
MPN121	155976..156341	C09_orf121	g1673681	C09_orf121	conserved hypothetical				MG202			Only hits MG;	MP033	complement(49460..49825)
Thr-tRNA(ACC)	complement(156359..156432)	mptgt			in Genbank, [tRNA] /note="codon recognized: GGT" and [gene] /note="Thr-tRNA(GGU) gene" are wrong.								complement(156359..156432)	49369..49442
MPN122	156467..158374	parB	g1673680	C09_orf635	conf, topoisomerase IV subunit B		1BGW, 1AJ6		MG203	MPN003	lc: 458..471;	sub; B TOPOISOMERASE IV	MP032	complement(47427..49334)
MPN123	158374..160743	parC	g1673679	C09_orf789	conf, topoisomerase IV subunit A		1AB4		MG204	MPN004	cc: 432..463; lc: 289..303;	sub; A TOPOISOMERASE IV	MP031	complement(45058..47427)
MPN124	complement(160730..161785)	yqxE	g1673678	C09_orf351	conf, protein (hrcA) homolog; similar to Swiss-Prot Accession Number P25499, from B. subtilis			cell control	MG205		cc: 317..343;	represses expression of Dnak and GroE operons	MP030	44016..45071
MPN125	161817..163577	uvrC	g1673677	C09_orf586L	conf, excinuclease ABC subunit C				MG206		lc: 317..330;	sub; Subunit C EXCINUCLEASE ABC	MP029	complement(42224..43984)
MPN126	163613..164092	C09_orf159	g1673676	C09_orf159	conf, MG207 homolog, from M. genitalium				MG207			2D-Gel data from ZMBH	MP028	complement(41709..42188)
MPN127	164484..165026	C09_orf180	g1673675	C09_orf180	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URF but exp: RNA data from ZMBH, RNA-expressed;	MP027	complement(40775..41317)
MPN128	166483..166932	C09_orf149a	g1673674	C09_orf149a	conf, see: MP013					MPN141, MPN101, MPN502, MPN462, MPN205	lc: 26..45;		MP026	complement(38869..39318)
MPN129	167632..168081	C09_orf149b	g1673673	C09_orf149b	conf, adhesin P1 (group 2) homolog; similar to GenBank Accession Number A41480, from M. pneumoniae					MPN090, MPN085	tm: 41..61 88..108 113..133;		MP025	complement(37720..38169)
MPN130	169042..169464	C09_orf140o	g1673672	C09_orf140o	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 97..139;	URF but exp: RNA data from ZMBH, RNA-expressed;	MP024	complement(36337..36759)
MPN131	170068..170733	E07_orf221V	g1673670	E07_orf221V	conf, see: MP013					MPN144, MPN141, MPN500, MPN468, MPN409, MPN370, MPN286, MPN202	lc: 20..36 111..126 184..199;		MP023	complement(35068..35733)
MPN132	171049..171819	E07_orf256L	g1673669	E07_orf256L	conf, see: MP013					MPN144, MPN141, MPN099, MPN500, MPN409, MPN370, MPN286, MPN203, MPN202	lc: 53..75 126..137 155..167 170..186;		MP022	complement(33982..34752)
MPN133	172277..173182	E07_orf301	g1673668	E07_orf301	conf, putative lipoprotein, MG186 homolog, from M. genitalium				MG186		sp: 1..26; cc: 62..94; lc: 227..240;		MP021	complement(32619..33524)
MPN134	173206..174966	ugpC	g1673667	E07_orf586	conf, sn-glycerol-3-phosphate transport system permease protein			Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit;	MG187	MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193	cc: 229..254 320..346;	add: 123-336 insertion of charge residues, 2D-Gel data from ZMBH Ges.	MP020	complement(30835..32595)
MPN135	174959..175948	ugpA	g1673666	E07_orf329	conf, sn-glycerol-3-phosphate transport system permease protein			Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit;	MG188	MPN136	tm: 32..52 97..117 127..147 232..252 283..303;		MP019	complement(29853..30842)
MPN136	175920..176879	ugpE	g1673665	E07_orf319	conf, sn-glycerol-3-phosphate transport system permease protein			Transporter, ABC superfamily; sn-glycerol-3-phosphate transporter subunit;	MG189	MPN135	tm: 41..61 103..123 134..154 169..189 230..250 283..303;		MP018	complement(28922..29881)
MPN137	complement(177457..178143)	E07_orf228	g1673664	E07_orf228	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 113..222;	URF but exp: RNA data from ZMBH, RNA-expressed;	MP017	27658..28344
MPN138	complement(178392..178892)	E07_orf166	g1673663	E07_orf166	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 69..149;	URF but exp: RNA data from ZMBH, RNA-expressed;	MP016	26909..27409
MPN139	complement(179129..179620)	E07_orf163	g1673662	E07_orf163	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 76..103;	URF but exp: RNA data from ZMBH, RNA-expressed;	MP015	26181..26672
MPN140	179871..180845	orf4	g1673660	E07_orf324	new_conf, DHH family phosphoesterases				MG190	MPN549		new_conf;(17-320)Pfam:PF01368 DHH family Evalue 1e-05 exp;Trends Biochem Sci 23: 17-19 (1998)[PMID9478130,MUID98138617] A novel family of predicted phosphoesterases includes Drosophila prune protein and bacterial RecJ exonuclease. L. Aravind & E. V. Koonin; exp: RNA data from ZMBH, RNA-expressed; The phosphoesterase should functinally aid the attachment -> could have pharmacological implications. P1 cytadherence operon;	MP014	complement(24956..25930)
MPN141	180858..185741	P1	g1673659	E07_orf1627	conf, ADP1_MYCPN adhesin P1				MG191	MPN144, MPN142, MPN132, MPN131, MPN128, MPN101, MPN099, MPN502, MPN500, MPN468, MPN462, MPN453, MPN409, MPN370, MPN286, MPN205, MPN203, MPN202	sp: 1..27; tm: 530..550 1105..1125 1527..1547; lc: 261..280 337..350 832..849 963..975 1225..1237 1298..1326;	2D-Gel data from ZMBH, Ges., ca. 80 kD, IEP ca. 7.3 former expression study; P1 cytadherence operon;	MP013	complement(20060..24943)
MPN142	185747..189403	orf6	g1673658	E07_orf1218	new_conf, involved in cytadherence				MG192	MPN150, MPN149, MPN141, MPN102, MPN093, MPN092, MPN503, MPN464, MPN414, MPN367, MPN366	sp: 1..23; tm: 1123..1143; lc: 116..132 297..324 538..551;	exp: RNA data from ZMBH, former expression result, 2D-Gel data from ZMBH, N-term 40kD Fragment, IEP ca. 10.1, RNA-expressed; orf6 of P1 cytadherence operon, the 130kD precursor, this splits into 40kD(B) and 90kDa(C), cytadherence associated, exact molecular function unknown; Note that MP012-MP014 probably form an operon as suggested (not more) by RBS and termination site for polycistronic messenger (Gene 82, 259-267; Inamine et al.,1989; UI: 90060815 ) ; however a point mutation in the P1 gene is accompanied by the loss of B and C (Krause,D. Mol Microbiol 20,247-253; 1996). With the experimental data and the literature this protein is no longer hypothetical.	MP012	complement(16398..20054)
MPN143	189520..190047	E07_orf175	g1673657	E07_orf175	hypothetical							Hits nothing, URF?;	MP011	complement(15754..16281)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN144	190621..191862	E07_orf413	g1673656	E07_orf413	conf, see: MP013					MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN286, MPN203, MPN202	lc: 43..55 264..284 303..318 375..401;		MP010	complement(13939..15180)
MPN145	192214..192753	E07_orf179	g1673655	E07_orf179	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 152..178; lc: 58..71;	URF, but exp: RNA data from ZMBH, RNA-expressed;	MP009	complement(13048..13587)
MPN146	193071..193868	E07_orf265	g1673654	E07_orf265	conserved hypothetical, see: MP631					MPN152, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN281, MPN200, MPN199		see comments to MP631.	MP008	complement(11933..12730)
MPN147	193875..195332	E07_orf485	g1673653	E07_orf485	conserved hypothetical, see: MP631					MPN152, MPN098, MPN097, MPN506, MPN408, MPN364, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199	lc: 155..174;	see comments to MP631.	MP007	complement(10469..11926)
MPN148	195875..196297	E07_orf140	g1673652	E07_orf140	conserved hypothetical, see: MP199					MPN012, MPN011, MPN649, MPN505, MPN466, MPN411, MPN369, MPN271			MP006	complement(9504..9926)
MPN149	196850..198154	E07_orf434	g1673650	E07_orf434	new_conf, see: MP012					MPN142, MPN102, MPN092, MPN503, MPN464, MPN414, MPN367, MPN366	lc: 70..86;	but exp: RNA data from ZMBH, RNA-expressed;	MP005	complement(7647..8951)
MPN150	197982..198656	E07_orf224	g1673649	E07_orf224	new_conf, see: MP012					MPN142, MPN102, MPN093, MPN503, MPN464, MPN414, MPN367		but exp: RNA data from ZMBH, RNA-expressed;	MP004	complement(7145..7819)
MPN151	199139..199540	E07_orf133	g1673648	E07_orf133	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URF; but exp: RNA data from ZMBH, RNA-expressed;	MP003	complement(6261..6662)
MPN152	199823..202207	E07_orf794	g1673647	E07_orf794	conserved hypothetical, see: MP631					MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199	sp: 1..27; lc: 39..52 229..244 472..501;	less, see comments to MP631. 2D-Gel data from ZMBH, 17kD, Ges., IEP ca. 10 ?	MP002	complement(3594..5978)
MPN153	202383..205724	E07_orf1113	g1673646	E07_orf1113	conserved hypothetical, MG140 homolog, from M. genitalium				MG140		lc: 958..970 1003..1016;		MP001	complement(77..3418)
Leu-tRNA(TTG)	205801..648993												205801..648993	complement(373202-373283)
MPN154	205801..207423	nusA	g1674384	E07_orf540o	conf, N-utilization substance protein A homolog; similar to Swiss-Prot Accession Number P32727, from B. subtilis				MG141	MPN452, MPN447, MPN167	lc: 67..83 453..504;	Significant similarity to nusA from other bacterias. Other nusA is -500 aa and similar region between MP677 and others is from N-terminal to 370 aa. Rest of the segment have no similarity, except for MG.	MP677	complement(814772..816394)
MPN155	207704..209557	infB	g1674382	VXpSPT7_orf617	conf, protein synthesis initiation factor 2		1EFU		MG142	MPN665, MPN475, MPN279, MPN227	cc: 386..418;	sub translation initiation afctor; Only MP and MG have much shorter sequences. Others have 100-300 more residues at their N-terminal. One of the three factors required for the initiation of protein biosynthesis in bacteria. Other factors are: IF-1 (infA) (MP644) and IF-3 (infC) (MP039).	MP676	complement(812638..814491)
MPN156	209560..209910	rbfA	g1674381	VXpSPT7_orf116	conf, ribosome binding factor A				MG143			SUB;	MP675	complement(812285..812635)
MPN157	209926..211134	VXpSPT7_orf402	g1674380	VXpSPT7_orf402	conserved hypothetical				MG144	MPN452	tm: 279..299 328..348 359..379; lc: 49..72 114..151 161..184;	No homologs other than MG144, which has 279 aa and match C-terminal part of MP674. N-termianl 120 aa of MP674 has no homology. exp: RNA data from ZMBH, RNA-expressed;	MP674	complement(811061..812269)
MPN158	211147..211956	yaaC	g1674379	VXpSPT7_orf269	conf, riboflavin kinase (EC 2.7.1.26) (flavokinase) / FMN adenylyltransferase (EC 2.7.7.2) (FAD pyrophosphorylase) (FAD synthetase); bifunctional			(EC 2.7.1.26) ATP + riboflavin = ADP + FMN; (EC 2.7.7.2) ATP + FMN = diphosphate + FAD. hypothesis: Can do in fact also ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD(+) EC 2.7.7.18	MG145			conf, because the description in P22990 means exactly that;SwissProt (P75587, RIBF_MYCPN) and Koonin's annotation to MG145 already assigned this double function, too. exp: _CORAM UI: 98322073; Though this is a bifunctional enzyme, the two reactions occur at a single active site. Bold hypothesis (has to be checked by experiment): reaction EC 2.7.7.18 for NAD synthesis pathway (see MP107, MP280) is also possible by this enzyme. exp: RNA data from ZMBH, RNA-expressed;	MP673	complement(810239..811048)
MPN159	211982..213256	hlyC	g1674378	VXpSPT7_orf424	wrong_, tlyC homolog, hemolysin activity doubtful, see comments				MG146		sp: 1..29; tm: 67..87 100..120 134..154;	wrong: not hlyC homolog but tlyC homolog; 1-29, signal peptide; 67-87, TM; 100-120, TM; 134-154, TM; 215-264, CBS (e=3.6e-4); 278-326, CBS (e=0.11); This entry has significant similarity to 'hypothetical' and 'hemolysin homolog' proteins. But no similarity to hemolysins (hlyC) from gram-negative bacterias. exp: _TREHY UI: 95058097; So far, only one paper about hemolytic activity of tlyC from Serpulina hyodysenteriae: MICROB. PATHOG. 16:269-82 (1994). This sequence is shorter (268 aa) than MP, and corresponds to 150-350 of MP.	MP672	complement(808939..810213)
MPN160	213243..214376	VXpSPT7_orf377	g1674377	VXpSPT7_orf377	conserved hypothetical				MG147		sp: 1..37; tm: 66..86 160..180 205..225 293..313 335..355;	No homologs other than MG147. 1-37, signal peptide; 66-86, TM; 160-180, TM; 205-225, TM; 293-313, TM; 335-355, TM exp: RNA data from ZMBH, RNA-expressed;	MP671	complement(807819..808952)
MPN161	214530..215867	VXpSPT7_orf445	g1674376	VXpSPT7_orf445	conserved hypothetical				MG148		cc: 85..192 411..437; lc: 47..61;	No homologs other than MG148. 85-192, CC; 411-438, CC. exp: RNA data from ZMBH, 32 degrees once, but clear, RNA-expressed; exp-PH: XDVKYLQVE N-term as predicted; could be expressed in Hep C8;	MP670	complement(806328..807665)
MPN162	215989..216951	VXpSPT7_orf320	g1674375	VXpSPT7_orf320	conserved hypothetical				MG149		sp: 1..25; lc: 62..82 86..98 171..186 206..258;	No homologs other than MG149. 1-25, signal peptide. Characteristics of lipoproteins, i.e., (i) one or more basic residues near N-terminal, (ii) signal peptide, and (iii) a Cys residue downstream of the signal peptide, can be seen both of the MP and MG sequences.	MP669	complement(805244..806206)
MPN163	217198..217536	VXpSPT7_orf112	g1674374	VXpSPT7_orf112	conserved hypothetical				MG149.1		sp: 1..33; tm: 38..58; lc: 79..91;	1-33, Signal peptide; 38-58, TM. PSI-Blast detects nothing other than MG149.1.	MP668	complement(804659..804997)
MPN164	217630..217956	rpsJ	g1674372	VXpSPT7_orf108	conf, ribosomal protein S10				MG150		lc: 29..44;	SUB;	MP667	complement(804239..804565)
MPN165	217970..218833	rplC	g1674371	VXpSPT7_orf287	conf, ribosomal protein L3				MG151		lc: 228..252;	SUB; MP sequence is much longer than others. MG lacks C-terminal 30 residues, and others lack C-terminal 50-70 residues comparing to MP.	MP666	complement(803362..804225)
MPN166	218833..219471	rplD	g1674370	VXpSPT7_orf212	conf, ribosomal protein L4				MG152		lc: 156..168;	SUB;	MP665	complement(802724..803362)
MPN167	219474..220187	rplW	g1674369	VXpSPT7_orf237	conf, ribosomal protein L23				MG153; MG219		lc: 152..198;	SUB; L23 proteins have about 100 residues. Only MP sequence has much longer C-terminal 130 residues. This segment was subjected to homology search (PSI-Blast), but there is no significant homolog. This segment is rich in K, E, A, V, and T. In the segment, 82.5% of the residues are either one of the five amino acids.	MP664	complement(802008..802721)
MPN168	220187..221050	rplB	g1674368	VXpSPT7_orf287	conf, ribosomal protein L2				MG154			SUB;	MP663	complement(801145..802008)
MPN169	221050..221313	rpS19	g1674367	VXpSPT7_orf87	conf, ribosomal protein S19				MG155			SUB;	MP662	complement(800882..801145)
MPN170	221240..221794	VXpSPT7_orf184	g1674366	VXpSPT7_orf184	conf, ribosomal protein L22		1BXE		MG156			SUB; Only MP and MG have much longer N- and C-terminal residues (N-terminal 20-25 residues; C-terminal 30-50 residues). SwissProt assigns 26-Met as the first residue for both MP and MG. Bairoch: This starts at MIAFAK... (so 25 aa shorter at N-term). Mikita sees only 1bp intergenic region and that MP661/662 have 74 nts overlap.	MP661	complement(800401..800955)
MPN171	221796..222617	rpsC	g1674365	VXpSPT7_orf273	conf, ribosomal protein S3				MG157		lc: 85..96 225..238;	SUB; Only MP and MG have much longer C-terminal sequences (40-50 residues).	MP660	complement(799578..800399)
MPN172	222617..223036	rplP	g1674364	VXpSPT7_orf139	conf, ribosomal protein L16				MG158			SUB;	MP659	complement(799159..799578)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN173	223036..223371	rpmC	g1674363	GT9_orf111b	conf, ribosomal protein L29				MG159		lc: 47..59;	SUB;	MP658	complement(798824..799159)
MPN174	223371..223628	rpsQ	g1674362	GT9_orf85	conf, ribosomal protein S17		1RIP		MG160			SUB;	MP657	complement(798567..798824)
MPN175	223632..224000	rplN	g1674361	GT9_orf122	conf, ribosomal protein L14		1WHI		MG161			SUB;	MP656	complement(798195..798563)
MPN176	224000..224335	rplX	g1674360	GT9_orf111a	conf, ribosomal protein L24				MG162			SUB;	MP655	complement(797860..798195)
MPN177	224338..224880	rplE	g1674359	GT9_orf180b	conf, ribosomal protein L5				MG163		lc: 166..177;	SUB;	MP654	complement(797315..797857)
MPN178	224882..225067	rpsN	g1674358	GT9_orf61	conf, ribosomal protein S14				MG164			SUB;	MP653	complement(797128..797313)
MPN179	225061..225489	rpsH	g1674357	GT9_orf142	conf, ribosomal protein S8		1AN7-A		MG165			SUB; Only MP and MG have much longer N-terminal sequences (10 residues).	MP652	complement(796706..797134)
MPN180	225496..226050	rplF	g1674356	GT9_orf184	conf, ribosomal protein L6				MG166			SUB;	MP651	complement(796145..796699)
MPN181	226051..226401	rplR	g1674355	GT9_orf116b	conf, ribosomal protein L18				MG167		lc: 52..63;	SUB;	MP650	complement(795794..796144)
MPN182	226405..227064	rpsE	g1674354	GT9_orf219	conf, ribosomal protein S5		1PKP		MG168		lc: 157..174;	SUB; Only MP and MG have much longer N-terminal sequences (50-60 residues).	MP649	complement(795131..795790)
MPN183	227068..227523	rplO	g1674353	GT9_orf151	conf, ribosomal protein L15				MG169			SUB;	MP648	complement(794672..795127)
MPN184	227523..228956	secY	g1674352	GT9_orf477	conf, preprotein translocase subunit SecY	83-433, secY (Pfam)			MG170	MPN080	sp: 1..46; tm: 82..102 129..149 165..185 211..231 234..254 286..306 327..347 387..407 412..432; lc: 67..81;	sub protein export; One of the components for protein export. Other components are: secA (MP621) and secE (MP086?).	MP647	complement(793239..794672)
MPN185	228950..229597	adk	g1674351	GT9_orf215	conf, adenylate kinase		3ADK	Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis(EC 2.7.4.3); adenylate kinase ATP + AMP = ADP + ADP; note: works also with other NTP.	MG171				MP646	complement(792598..793245)
MPN186	229597..230343	map	g1674350	GT9_orf248	conf, methionine amino peptidase		1CHM-A	(EC 3.4.11.18) L-methionylpeptide + H2O = L-methionine + peptide	MG172				MP645	complement(791852..792598)
MPN187	230343..230579	infA	g1674349	GT9_orf78	conf, initiation factor 1		1AH9		MG173			sub translation initiation factor; One of the three factors required for the initiation of protein biosynthesis in bacteria. Other factors are: IF-2 (infB) (MP676) and IF-3 (infC) (MP039).	MP644	complement(791616..791852)
MPN188	230590..230703	rpmJ	g1674348	GT9_orf37	conf, ribosomal protein L36				MG174			SUB;	MP643	complement(791492..791605)
MPN189	230703..231077	rpsM	g1674347	GT9_orf124b	conf, ribosomal protein S13				MG175			SUB;	MP642	complement(791118..791492)
MPN190	231077..231442	rpsK	g1674346	GT9_orf121	conf, ribosomal protein S11				MG176			SUB;	MP641	complement(790753..791118)
MPN191	231448..232431	rpoA	g1674345	GT9_orf327	conf, RNA polymerase alpha core subunit		1COO		MG177			sub RNA polymerase	MP640	complement(789764..790747)
MPN192	232434..232808	rplQ	g1674344	GT9_orf124a	conf, ribosomal protein L17	17-119, Ribosomal_L17 (Pfam)			MG178			SUB;	MP639	complement(789387..789761)
MPN193	232792..233616	cysA	g1674343	GT9_orf274	less, cobalt transport ATP-binding protein	35-217, ABC_tran (Pfam)		Transporter, ABC superfamily; cobalt transporter subunit;	MG179	MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN571, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN194		less: this sequence is higher similar to cobalt transporter than sulfate transporter; sub ABC transporter	MP638	complement(788579..789403)
MPN194	233604..234515	hisP	g1674342	GT9_orf303	less, cobalt transport ATP-binding protein	47-236, ABC_tran (Pfam)		Transporter, ABC superfamily; cobalt transporter subunit;	MG180	MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN217, MPN193		less: this sequence is higher similar to cobalt transporter than histidine transporter; sub ABC transporter	MP637	complement(787680..788591)
MPN195	234508..235812	GT9_orf434	g1674341	GT9_orf434	new_conf, similar to cobalt transport membrane protein			Transporter, ABC superfamily; cobalt transporter subunit;	MG181	MPN431	sp: 1..42; tm: 67..87 252..272 384..404; lc: 46..58;	new_conf Paulsen already classified as ABC transporter membrane protein; sub ABC transporter; Further homolog: MP410 and MG302	MP636	complement(786383..787687)
MPN196	235805..236536	hisT	g1674340	GT9_orf243V	conf, pseudouridylate synthase I			(EC 4.2.1.70) uracil + D-ribose 5-phosphate = pseudouridine 5'-phosphate + H2O	MG182			exp: RNA data from ZMBH, no expression, is hypothetical !	MP635	complement(785659..786390)
MPN197	236529..238364	pepF	g1674339	GT9_orf611	conf, oligoendopeptidase F				MG183				MP634	complement(783831..785666)
MPN198	238364..239323	mte1	g1674338	GT9_orf319V	conf, adenine-specific methyltransferase EcoRI			(EC 2.1.1.72) S-adenosyl-L-methionine + DNA adenine = S-adenosyl-L-homocysteine + DNA 6-methylaminopurine	MG184				MP633	complement(782872..783831)
MPN199	239417..241699	GT9_orf760	g1674337	GT9_orf760	see: MP631 conserved hypothetical				MG185	MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200	sp: 1..25; lc: 552..568;	see comments to MP631.	MP632	complement(780496..782778)
MPN200	241983..244379	GT9_orf798	g1674335	GT9_orf798	conserved hypothetical					MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN491, MPN408, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN199	sp: 1..18; cc: 540..565; lc: 228..242;	No significant homologs other than MP and MG. Family with 15 members. Among the members, MP002, MP336, MP430, MP547, MP551, MP631, MP632 have similarity in whole length with each other. Rest of the members, MP007, MP008, MP056, MP057, MP472, MP473, MP553, MP554, are parts of MP631 (representative). Homolog, but no orthologue in MG: MG185, MG260 exp: RNA data from ZMBH, RNA-expressed;	MP631	complement(777816..780212)
MPN201	244853..245569	GT9_orf238	g1674334	GT9_orf238	conf,see: MP335					MPN089, MPN615, MPN507, MPN365, MPN343, MPN290, MPN289, MPN285		member of a family of restriction enzymes; 1.7e-20 till res 326 to M.pulmonis restr. system; exp evidence for M.pulmonis in PNAS 95, 13923 (1998) see main representative MP335	MP630	complement(776626..777342)
MPN202	246049..246990	GT9_orf313	g1674333	GT9_orf313	conf, see: MP013					MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN286	lc: 249..268;		MP629	complement(775205..776146)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN203	246909..247292	GT9_orf127	g1674332	GT9_orf127	conf, see: MP013					MPN144, MPN141, MPN132, MPN099, MPN500, MPN409	sp: 1..22; lc: 91..105;		MP628	complement(774903..775286)
MPN204	247655..248101	GT9_orf148	g1674331	GT9_orf148	conserved hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URF exp: RNA data from ZMBH, RNA-expressed;	MP627	complement(774094..774540)
MPN205	248562..249878	GT9_orf438V	g1674330	GT9_orf438V	conf, see: MP013					MPN141, MPN128, MPN101, MPN502, MPN462, MPN370	lc: 23..38 130..139 169..191 245..259;		MP626	complement(772317..773633)
MPN206	complement(249933..250274)	GT9_orf113	g1674329	GT9_orf113	hypothetical						lc: 63..78;	Only the N-terminal 62 residues have similarity to M. genitalium hypothetical protein fragment (SPTREMBL Q49241; len=66) with e=1e-04, 45% identity. 63-78, SEG. exp: RNA data from ZMBH, RNA-expressed;	MP625	771921..772262
MPN207	250326..253148	ptsG	g1674328	GT9_orf940o	conf, PTS system, glucose-specific IIABC component	664-692, PTS_EIIB (Pfam); 794-856, PTS_EIIA (Pfam)	1AX3, 1IBA	transporter, PTS; sugar transport: glucose, input for glycolysis;	MG069	MPN313, MPN268, MPN259	tm: 40..60 85..105 110..130 170..190 209..229 488..508 514..534 537..557 598..618; lc: 240..252 635..647;	sub PTS; C, B, A domains are in a single chain in this order.	MP624	complement(769047..771869)
MPN208	253758..254642	rpsB	g1674326	G07_orf294	conf, ribosomal protein S2				MG070		cc: 132..160;	SUB;	MP623	complement(767553..768437)
MPN209	254635..257253	mgtA	g1674325	G07_orf872V	less, cation-transporting P-type ATPase	42-62, TM; 83-709, E1-E2_ATPase (Pfam); 736-756, TM; 771-791, TM; 80-826, TM; 839-859, TM		Transporter, P-type ATPase; cations (Mg++, Ca++)	MG071		tm: 42..62 78..98 243..263 268..288 648..668 688..708 736..756 771..791 806..826 839..859;	less: Mg2+ is too specific. Most of the Blast hits are cation-transporting ATPase.	MP622	complement(764942..767560)
MPN210	257240..259666	secA	g1674324	G07_orf808	conf, preprotein translocase SecA	6-419, SecA_protein (Pfam)			MG072			sub protein export; One of the components for protein export. Other components are: secY (MP647), secE (MP086?). The intergenic region between MP589 and MP590 seems contain the other component, secG, of this system, because the intergenic region has similarity to yvaL in Bs (FEBS Lett.445;6-8 (1999)), and yavL is similar to secG (J.Bacteriol.181(6):1786-92 (1999)).	MP621	complement(762529..764955)
MPN211	259641..261614	uvrB	g1674323	G07_orf657	conf, excinuclease ABC subunit B		1A1V-A		MG073	MPN443		sub excinuclease; One of the three subunits of the ABC excision nuclease. Other subunits are: uvrA (MP223) and uvrC (MP029).	MP620	complement(760581..762554)
MPN212	261617..262024	G07_orf135	g1674322	G07_orf135	conserved hypothetical				MG074	MPN648	sp: 1..25;	1-25, signal peptide. Further homolog: MP194, MG441. PSI-Blast detects nothing other than these 4 homologs. exp: RNA data from ZMBH, RNA-expressed;	MP619	complement(760171..760578)
MPN213	262129..265221	G07_orf1030	g1674321	G07_orf1030	conserved hypothetical				MG075		sp: 1..16; lc: 17..29 567..579 596..619 644..660 893..907;	No homologs other than MG075. exp: RNA data from ZMBH, RNA-expressed;	MP618	complement(756974..760066)
MPN214	complement(265218..265634)	G07_orf138	g1674320	G07_orf138	conserved hypothetical				MG076	MPN046	sp: 1..42; tm: 48..68;	1-42, signal peptide; 48-68, TM; 118-138, TM. PSI-Blast detects nothing other than MG076. exp: RNA data from ZMBH, RNA-expressed;	MP617	756561..756977
MPN215	265910..267079	oppB	g1674318	G07_orf389a	conf, oligopeptide transport system permease protein OppB			Transporter, ABC superfamily; oligopeptide transporter subunit;	MG077	MPN216	sp: 1..16; tm: 85..105 116..136 161..181 221..241 265..285;	sub ABC transporter;	MP616	complement(755116..756285)
MPN216	267072..268202	amiD	g1674317	G07_orf376	conf, oligopeptide transport system permease protein AmiD			Transporter, ABC superfamily; oligopeptide transporter subunit;	MG078	MPN215	tm: 46..66 172..192 212..232 239..259 297..317 338..358;	sub;	MP615	complement(753993..755123)
MPN217	268204..269475	oppD	g1674316	G07_orf423	conf, oligopeptide transport ATP-binding protein OppD			Transporter, ABC superfamily; oligopeptide transporter subunit;	MG079	MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN258, MPN218, MPN194, MPN193	cc: 147..179; lc: 49..66;	sub;	MP614	complement(752720..753991)
MPN218	269438..271993	oppF	g1674315	G07_orf851	CONF, but only N- and C-term; inbetween (500AA) seg and coil			apart from big coil region (see comment): Transporter, ABC superfamily; oligopeptide transporter subunit;	MG080	MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN334, MPN217, MPN194, MPN193	cc: 267..290 507..577;	1-160 and 650-800, are N- and C-term of ATP binding part of oligopeptide ABC transporter. inbetween contains sec and coil, and hits CYTADHERENCE and myosin hits MP526 inbetween thus ... contacted miguel about MP526 annot true but inbetween N- and C-term :oligopeptide ABC transporter ATP binding subunit, AND inbetween (500AA) sec and coil; sub;	MP613	complement(750202..752757)
MPN219	272049..272462	rplK	g1674314	G07_orf137	conf, ribosomal protein L11		1ACI		MG081			SUB; sub;	MP612	complement(749733..750146)
MPN220	272462..273142	rplA	g1674313	G07_orf226	conf, ribosomal protein L1		1AD2		MG082		lc: 122..134;	SUB; sub;	MP611	complement(749053..749733)
MPN221	273142..273708	pth	g1674312	G07_orf188	conf, peptidyl-tRNA hydrolase		2PTH		MG083				MP610	complement(748487..749053)
MPN222	273701..274570	yacA	g1674311	G07_orf289	new_conf, similar to PP-loop superfamily ATPase/cell cycle protein MESJ homologues		1GPM-A		MG084			psi blast hits PP-loop superfamily ATPase/CELL CYCLE PROTEIN MESJ HOMOLOG this gene lies very close to its neighbor (MP608) interaction at the signal transduction level ??? pent in all domains of life.; new_conf more koonin; exp: RNA data from ZMBH, only once at 32 degrees, still doubtful;	MP609	complement(747625..748494)
MPN223	274571..275509	G07_orf312	g1674310	G07_orf312	new_conf, HPr(Ser) kinase				MG085		lc: 140..154;	new_conf; psi-blast HPr(Ser) kinase full length 26% to MEDLINE 99121006 bettr :30% (BS true ortholog) to MEDLINE 98230327 regulates ... COG1493 latest update also states serine kinase of the HPr. protein;	MP608	complement(746686..747624)
MPN224	275499..276668	lgt	g1674309	G07_orf389b	more__, prolipoprotein diacylglyceryl transferase but unknown TM contating C-term; bidomainal;				MG086		tm: 25..45 54..74 99..119 147..167 221..241 278..298 310..330; lc: 120..137;	smart: 7 or 8 TM regions in 389 AA. 1-280 hits prolipoprotein diacylglyceryl transferase C-term hits nothing except MP ortholog, but does contain one probable TM region.; new_conf more koonin, different MG genbankk and TIGR;	MP607	complement(745527..746696)
MPN225	276697..277116	rpsL	g1674308	G07_orf139	conf, ribosomal protein S12				MG087		lc: 9..22;	SUB; sub;	MP606	complement(745079..745498)
MPN226	277170..277637	rpsG	g1674307	G07_orf155	conf, ribosomal protein S7		1RSS		MG088			SUB; sub;	MP605	complement(744558..745025)
MPN227	277660..279726	fus	g1674306	G07_orf688	conf, elongation factor G		1DAR		MG089	MPN001, MPN665, MPN279, MPN155			MP604	complement(742469..744535)
MPN228	279783..280430	rpsF	g1674305	G07_orf215	conf, ribosomal protein S6 but seg N-term				MG090		lc: 187..210;	SUB; sub;	MP603	complement(741765..742412)
MPN229	280430..280930	ssb	g1674304	G07_orf166	conf, single-stranded DNA binding protein		3ULL-B		MG091				MP602	complement(741265..741765)
MPN230	280920..281234	rpsR	g1674303	G07_orf104b	conf, ribosomal protein S18				MG092		lc: 12..25;	SUB; sub;	MP601	complement(740961..741275)
MPN231	281237..281686	rplI	g1674302	G07_orf149	conf, ribosomal protein L9		1DIV		MG093			SUB;	MP600	complement(740509..740958)
MPN232	281673..283094	dnaB	g1674301	G07_orf473	conf, replicative DNA helicase DnaB		1REA		MG094		lc: 133..143;	exp: RNA data from ZMBH only once 32 degrees, makes sense, restr. enzyme.	MP599	complement(739101..740522)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN233	283098..284462	G07_orf454	g1674300	G07_orf454	new, excreted conserved protein				MG095		sp: 1..22; lc: 47..64;	psi-blast iteration hit complexity biased proteins and "antigens" from o.a. plasmodium. hits asparagine rich. lipo not completely clear to me (except for signal of course) unknown. exp: RNA data from ZMBH, RNA-expressed;	MP598	complement(737733..739097)
MPN234	285190..286443	G07_orf417	g1674299	G07_orf417	new, membrane export protein family see: MP334					MPN049, MPN048, MPN042, MPN039, MPN036, MPN035, MPN512, MPN511, MPN510, MPN509, MPN508	cc: 107..154;	putative, see MP334	MP597	complement(735752..737005)
MPN235	286468..287190	ung	g1674298	G07_orf240	conf, uracil DNA glycosylase		1LAU-E		MG097				MP596	complement(735005..735727)
MPN236	287388..288827	G07_orf479	g1674297	G07_orf479	more__, Glu-tRNA amidotransferase subunit C AND unknown TM contating N terminal domain; bidomainal;				MG098		tm: 16..36 61..81 106..126 133..153 176..196 229..249 290..310 333..353;	new_add:We can add the TM observation and discussion; Glu-tRNA amidotransferase subunit C is addition compared to genebank MP but was found in GenebankMG and in Sternberg paper; smart 8 TM regions.; new; 479 long. C term devoid of TM. C term 353/390-479 = gatC (Glu-tRNA amidotransferase subunit C). what does the TM mean ??? (if the orf really includes the TM ...) it could also mean that the process occurs at the plasma membrane... psi-blast with only N-term/middle yields convergence on MG ortholog and with a push hits to all TM regions in NADH reductase etc.	MP595	complement(733368..734807)
MPN237	288830..290266	G07_orf478V	g1674296	G07_orf478V	more__, Glu-tRNA amidotransferase, subunit A (gatA)				MG099		lc: 116..129;	hits Glu-tRNA amidotransferase, subunit A (gatA) in psi-blast (see neighbor). hits "MEDLINE 98004482" (from BS) with 31% full length; also included in the MG update;	MP594	complement(731929..733365)
MPN238	290256..291692	PET112	g1674295	G07_orf478o	new_conf, Glu-tRNA(Gln) amidotransferase, subunit B (gatB)				MG100	MPN028		active in expression at the translational level. lots of the hits in psi-blast are annotated as Glu-tRNA(Gln) amidotransferase, subunit B (gatB). which it IS. hits "MEDLINE 98004482" (from BS) with 35% iden full length; new_conf MG struct other; exp: RNA data from ZMBH, only expression at 32 degree and low, but still believe, is subunit to MP 594	MP593	complement(730503..731939)
MPN239	291667..292335	K04_orf222	g1674294	K04_orf222	conserved hypothetical				MG101			converges after hitting MG ortholog. exp: RNA data from ZMBH, RNA-expressed;	MP592	complement(729860..730528)
MPN240	292328..293275	trxB	g1674293	K04_orf315	conf, thioredoxin reductase		1BHY	Biosynthesis of cofactors, prosthetic groups and carrier; Thioredoxin; thioredoxin reductase; thioredoxin (ox) + NADPH = thioredoxin (red) + NADP;	MG102	MPN390	lc: 19..34;		MP591	complement(728920..729867)
MPN241	293265..294107	K04_orf280	g1674292	K04_orf280	conserved hypothetical				MG103			converges on hypotethicals in BS, MG, TB and streptomyces exp: RNA data from ZMBH, RNA-expressed;	MP590	complement(728088..728930)
MPN242	294140..294370		New identified	New identified	SecG								589-590	complement(727825..728055)
MPN243	294381..296561	vacB	g1674290	K04_orf726	new_conf, 3'-5' exoribonuclease, RNase R		1SRO	transcription - degradation of RNA	MG104		cc: 597..628;	new_conf, RNAse R is new; GenebankMG "viral assoc" Sternberg "cold shock DNA binding like" smart: Pfam:RNB 186-556, 597-629 COIL, 641-726 S1 pfam_rnb, The function of this region of similarity is uncertain S1 = Ribosomal protein S1-like RNA-binding domain but indirectly (via prosite + psi-blast) linked to ribonuclease family ... annotation (vacB) points in virulence direction quite correctly, (although first 80 AA hit nothing althoug there might be space for that) vacB = virulence gene, postranscriptional regulator. ribonuclease family?; exp:_COLI 98269059 show for this homologous sequence however, that it it IS a 3'-5' exoribonuclease, RNase R; confirmed also by latest COG update 0537 exoribonuclease;	MP589	complement(725634..727814)
MPN244	296561..297169	K04_orf202	g1674289	K04_orf202	conserved hypothetical				MG105		sp: 1..34;	hits other hypotheticals in eubacteria and archaea. 202 long. converges on hypotheticals. exp: RNA data from ZMBH, RNA-expressed;	MP588	complement(725026..725634)
MPN245	complement(297138..297788)	def	g1674288	K04_orf216	CONF, but excreted ?		1DFF		MG106		sp: 1..24;	smart signal peptide, and Pfam:Pep_deformylase 40 188 of 216 true. but signal peptide !! in front, excreted ??	MP587	724407..725057
MPN246	297610..298329	gmk	g1674287	K04_orf239	less, see comments; membrane-associated guanylate kinase homologue		1GKY	Purines, pyrimidines, nucleosides and nucleotides, Purine ribonucleotide biosynthesis; if 5'guanylate kinase than ATP + GMP = ADP + GDP. Note: works also with deoxy. if not, see comment, than protein binding, membrane associated;	MG107		sp: 1..30; cc: 187..209; lc: 34..49;	but if membrane associated: So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions.	MP586	complement(723866..724585)
MPN247	298329..299108	ptc1	g1674286	K04_orf259	conf, protein phoshatase 2C homolog; similar to Swiss-Prot Accession Number P35182, from S. cerevisiae		1A6Q		MG108				MP585	complement(723087..723866)
MPN248	299099..300268	K04_orf389	g1674285	K04_orf389	less, Ser/Thr/Tyr protein kinase		1APM-E		MG109		tm: 360..380;	smart: STYKc 15-309 TM 360-380. == Protein kinase; unclassified specificity true only hits this in psi-blast, but can be Ser/Thr/Tyr kinase thus not serine/threonine, but Ser/Thr/Tyr; less;	MP584	complement(721927..723096)
MPN249	300255..301091	yjeQ	g1674284	K04_orf278L	conserved hypothetical, 154-190 similar to GTP/ATP binding proteins				MG110			hits family of hypothetical proteins in eubacteria hits after iteration the gtp/atp binding sites of other proteins with 154-190 ... -> possible gtp/atp binding; new; exp: RNA data from ZMBH, no expression, is hypothetical !	MP583	complement(721104..721940)
MPN250	301113..302405	pgiB	g1674283	K04_orf430	conf, but first 70 AA			Energy metabolism, Glycolysis; phosphoglucose isomerase B (pgiB); glucose 6-phosphate = fructose 6-phosphate;	MG111		tm: 384..404;	only hits glucose 6-phosphate isomerase first 70 only hit MG and nothing else ... annotation is true, but first 70 .... ??	MP582	complement(719790..721082)
MPN251	302383..303030	cfxE	g1674282	K04_orf215L	conf, D-ribulose-5-phosphate 3 epimerase			Energy metabolism, Sugars; D-ribulose-5-phosphate 3 epimerase (cfxE); D-ribulose 5-phosphate = D-xylulose 5-phosphate;	MG112				MP581	complement(719165..719812)
MPN252	303037..304404	asnS	g1674281	K04_orf455o	conf, asparaginyl-tRNA synthetase		1ASY-A		MG113	MPN046, MPN277			MP580	complement(717791..719158)
MPN253	304361..305044	pgsA	g1674280	A65_orf227	conf, phosphatidylglycerophosphate synthase			Fatty acid and phospholipid metabolism; phosphatidylglycerophosphate synthase (pgsA); CDP-diacylglycerol + glycerol 3-phosphate = CMP + 3-(3-phosphatidyl)-glycerol 1-phosphate;	MG114		tm: 30..50 59..79 112..132 160..180 194..214;		MP579	complement(717151..717834)
MPN254	305066..305539		New identified	New identified	conserved hypothetical								578-579	complement(716656..717129)
MPN255	305565..306320	A65_orf251b	g1674278	A65_orf251b	conserved hypothetical				MG116	MPN269		psi-blast converges after hitting MG ortholog. exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP578	complement(715875..716630)
MPN256	306313..306984	A65_orf223	g1674277	A65_orf223	conserved hypothetical				MG117			hits MG ortholog and then converges. exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP577	complement(715211..715882)
MPN257	306965..307981	galE	g1674276	A65_orf338	conf, UDP-glucose 4-epimerase		1BXK-A	Purines, pyrimidines, nucleosides and nucleotides, Sugar-nucleotide biosynthesis and conversions; UDP-glucose 4-epimerase ; UDP-glucose = UDP-galactose .	MG118			exp: RNA data from ZMBH, no expression, is hypothetical; re-check why not expressed !	MP576	complement(714214..715230)
MPN258	307996..309714	yjcW	g1674275	A65_orf572	more_, sugar (ribose/galactose) ABC transporter ATP-binding subunit			Transporters, ABC superfamily; ribose/galactose transport, subunit;	MG119	MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN619, MPN609, MPN433, MPN432, MPN416, MPN334, MPN218, MPN217, MPN194, MPN193		smart: Pfam:ABC_tran 33-229 AND 355-550 (of 572)., which is the ATP-binding subunit of an ABC transporter. No TM in the protein. most hits are for ribose/galactose. Piece of sequence from 320-360 is "insterted" in the mycoplasma gene ... GALACTOSIDE as substrate experimentaly in E. coli ... stick with "sugar"; more_; sub ABC transporter; exp: RNA data from ZMBH, RNA-expressed;	MP575	complement(712481..714199)
MPN259	309731..311284	A65_orf517	g1674274	A65_orf517	new_conf, sugar (ribose/galactose) ABC transporter permease subunit, but C-term ???			Transporters, ABC superfamily; ribose/galactose transport, subunit;	MG120	MPN260	tm: 33..53 81..101 104..124 135..155 164..184 217..237 267..287 302..322 325..345 349..369; cc: 490..515;	517 AA long. 10 TM according to smart. apart from full length hits to MG and Mycoplasma fermentans, Hits to the first 360 AA. Homologs to MP573 with the first 350. first thing the N terminus thus hits are ribose/galactose like ABC transporters ... nice TRUE orthologs are also neighbors. (bv :BS3151 BS3150) rbsC-1, permease protein. C term tail evolves very fast (if only blasting with C-term does not find C-term Mycoplasma fermentans.) C-term ??; new_conf different koonin and genbank MG; sub ABC transporter;	MP574	complement(710911..712464)
MPN260	311284..312219	rbsC	g1674273	A65_orf311	conf, sugar (ribose/galactose) ABC transporter permease subunit			Transporters, ABC superfamily; ribose/galactose transport, subunit;	MG121	MPN259	sp: 1..31; tm: 41..61 75..95 149..169 198..218 228..248 251..271 279..299;	smart: 7-9 TM, long signal pep containing probable TM. 311 long. ABC transporter, 9 TM according to hits to swissprott. For some sugar (ribose/galactose); less; sub ABC transporter;	MP573	complement(709976..710911)
MPN261	312256..314391	topA	g1674272	A65_orf711	conf, DNA topoisomerase I		1ECL		MG122		lc: 58..69;		MP572	complement(707804..709939)
MPN262	314381..315808	A65_orf475	g1674271	A65_orf475	conserved hypothetical, similar to reticulocyte binding protein				MG123		sp: 1..44;	475 AA. smart: signal 1-40 probable TM in 20-40 ... after many iterations -> myosins Hits at first nothing except its MG homolog. Thereafter (i)the RETICULOCYTE BINDING PROTEIN comes in (a huge plasmodium protein) this protein should be involevd in the specific binding to and and recognition of target cells ... (ii) Dictyostelium discoideum containing leucine zipper-like domains and a AQ protein (aq_1732) with no annotation at all., except for signal and lots of SEG. all hits could be false positives (low complexity guys)	MP571	complement(706387..707814)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN263	315874..316182	trx	g1674270	A65_orf102	conf, thioredoxin		1AIU	Biosynthesis of cofactors, prosthetic groups and carrier; Thioredoxin;thioredoxin;redox substrate;	MG124				MP570	complement(706013..706321)
MPN264	316194..317039	A65_orf281	g1674269	A65_orf281	new_conf, 150-end, similar to phosphate hydrolising				MG125	MPN427, MPN383	lc: 3..14;	281 AA; smart: Pfam:DUF3 4-265. = "Domain apparently occurring exclusively in eubacteria. Unknown function." many homologs; all unknown function. after iteration 2 the phosphoserine phosphatase (first) and transportATPase come in ... the phosphoserine phosphatase hits are in the 200-end region ... the transportATPase more 150-end ... orthophospate removing ... hydrolase of phospahte binding ...; new_conf koonin MG; exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP569	complement(705156..706001)
MPN265	complement(317047..318087)	trpS	g1674268	A65_orf346	conf, tryptophanyl-tRNA synthetase		1TYA-E		MG126				MP568	704108..705148
MPN266	318144..318581	ygl1	g1674267	A65_orf145	new_conf, similar to (oxido/arsenate) reductase				MG127			hits first hypo'd then (after it.) ARSENATE REDUCTASE ... all ARSENATE REDUCTASE are more similar to each other th;an to the small family of hypo's containing MP567 ... -> (oxido) reductase ... some species (for exa EC) contain the real ARSENATE REDUCTASE and the MP567 ortholog.;new_conf koonin MG; exp: RNA data from ZMBH, RNA-expressed;	MP567	complement(703614..704051)
MPN267	318581..319360	A65_orf259	g1674266	A65_orf259	conserved hypothetical				MG128			hits full length (259) all kinds of hyotheticals in all kinds of organisms ... ultimatly converges only on hypo's ... exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP566	complement(702835..703614)
MPN268	319360..319713	A65_orf117	g1674265	A65_orf117	new_conf, similar to PTS system: EIIB and N-term part of EIIC; bidomainal;		1IBA		MG129	MPN207	sp: 1..26;	hits of course first MG ortholog then hits PTS system II, first hits are to glucose specific ... NOT EIIA DOMAIN, is EIIB DOMAIN ... and 30 AA cterm of EIIC oid. can be reciprocally found by iterative psi-blast. contains probably phosphorylation site. pdb hit = pdb 1IBA; to be phosphyrilated Cysteine aligns with serine ?? and is thus not conserved. remember hits are not obvious, are distant. partial homolog = MP624. IIC is supposed to bind and transport the suger. seems true orthology because of lack of alternatives in MP ... First 20AA are according to annotated psi-blast hits TM. But not according to smart.;new_conf koonin, EMBL MG, EMBL structure, genbank MG; sub PTS system;	MP565	complement(702482..702835)
MPN269	319703..321184	ysr1	g1674264	A65_orf493	conf, nucleotide binding protein				MG130		sp: 1..41; cc: 63..94;	493 AA, smart long signal (40), this signal in its last 20AA contains probable TM. 63 95 coils ... Second iteration -> myosins ... C term hits hypotheticals (clear family in eubact) and then coiled mess. ?; Iterations of pis-blast with N-term hit different nucleotide binding proteins. exp: RNA data from ZMBH, RNA-expressed;	MP564	complement(701011..702492)
MPN270	321187..321474		New identified	New identified	conserved hypothetical								563-564	complement(700721..701008)
MPN271	321736..322491	A65_orf251a	g1674262	A65_orf251a	see: MP199 conserved hypothetical					MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN369, MPN332	sp: 1..31;		MP563	complement(699704..700459)
MPN272	324197..324478		A65_orf94	A65_orf94	hypothetical								MPN272	complement(697717..697998)
MPN273	complement(324455..324889)	hit1	g1674261	A65_orf144	new_conf, nucleotidyl hydrolases/transferase		1GUP-A		MG132			BELONGS TO THE HIT FAMILY -> histidine triad -> unifying the HIT family as nucleotidyl hydrolases, transferases, or both. Also called PROTEIN KINASE C INHIBITOR omni-pent family; new_conf EMBL structure, as well as described by Sternberg; exp: RNA data from ZMBH, RNA-expressed;	MP562	697306..697740
MPN274	complement(324858..325658)	A65_orf266	g1674260	A65_orf266	new, ABC transporter (sulfate/molybdenum) permease subunit				MG133	MPN666	sp: 1..40; tm: 89..109 151..171 232..252;	smart: very long signal peptide. 3 or 5 TM regions ... only 266 AA long. part of signal might also be TM -> probably at least 4 TM first hits only MG orthologs + MP and MG homologs (see also MP homolog: MP176) after a while start hitting TRANSPORTERS. ABC/SULFATE(full)/MOLYBDENUM(start at 70) hits translocation; sub ABC transporter; new;	MP561	696537..697337
MPN275	325680..325982	yaaK	g1674259	A65_orf100	conserved hypothetical				MG134			SMART: nothing (its is short 100AA) nice family of hypotheticals can be founs after iterations. hits very vaguely a putative cytoplasmic protein ... hits nothing else except family members form different species and then converges. exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP560	complement(696213..696515)
MPN276	complement(325954..326811)	A65_orf285	g1674258	A65_orf285	conserved hypothetical				MG135		tm: 31..51 84..104 108..128 150..170 173..193 236..256;	6 TM regions in a 285 AA prot .. only hits MG and (Mycoplasma gallisepticum) and then converges ... exp: RNA data from ZMBH, RNA-expressed;	MP559	695384..696241
MPN277	326856..328325	lysS	g1674257	A65_orf489	conf, lysyl-tRNA synthetase		1LYL-A		MG136	MPN046, MPN252			MP558	complement(693870..695339)
MPN278	328285..329484	yefE	g1674256	A65_orf399V	new_conf, udp-galactopyranose mutase		1AOG-A		MG137			smart: nothing UDP-GALACTOPYRANOSE MUTASE full length hit to experminetal determined GLF_ECOLI; new_conf differnt/more than TIGR koonin; new_conf exactly this in swiss prot; UI 96165258;	MP557	complement(692711..693910)
MPN279	329484..331229	lepA	g1674255	A65_orf581	conf, GTP-binding membrane protein LepA		1AIP, 2EFG-A		MG138	MPN665, MPN481, MPN227, MPN155			MP556	complement(690966..692711)
MPN280	331360..333069	A65_orf569	g1674253	A65_orf569	new, similar to single stranded RNA(DNA) processing enzymes		1BC2-A		MG139	MPN621	lc: 32..47;	new; SMART: 18 223 Pfam:lactamase_B superfamily thing hits distantly putative single strand RNA/DNA editing enzymes ... see also C12_orf561 !, is family of unknowns in eubacteria and archaea CLEAVAGE AND POLYADENYLATION and ATP binding start to surface ... hits 14-434 (of 569) in bos taurus MEDLINE 97078155; new, differnt from koonin and tobias; cons. hyp GenebankMG; Zn metallo-beta-lactamase Sternberg; COG595 predicts metal hydrolase 3; (consistent with our prediction, we think we can be more specific;)	MP555	complement(689126..690835)
MPN281	333280..334413	A65_orf377	g1674252	A65_orf377	see: MP631 conserved hypothetical					MPN152, MPN147, MPN146, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN284, MPN200, MPN199	sp: 1..21; lc: 246..258;	see comments to MP631.	MP554	complement(687782..688915)
MPN282	334768..335268	A65_orf166	g1674251	A65_orf166	see: MP631, conserved hypothetical					MPN152, MPN147, MPN098, MPN097, MPN506, MPN408, MPN364, MPN288, MPN284, MPN200, MPN199	lc: 57..70;	see comments to MP631.	MP553	complement(686927..687427)
MPN283	336479..336826	A65_orf115	g1674250	A65_orf115	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	lc: 43..55;	URF exp: RNA data from ZMBH, RNA-expressed;	MP552	complement(685369..685716)
MPN284	337770..340154	A65_orf794	g1674249	A65_orf794	see: MP631 conserved hypothetical				MG260	MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN288, MPN282, MPN281, MPN200, MPN199	sp: 1..18; lc: 218..236 462..475;	see comments to MP631.	MP551	complement(682041..684425)
MPN285	340613..341533	prrB	g1674248	A65_orf306	conf, type I restriction enzyme ecokI specificity protein see: MP335					MPN089, MPN638, MPN615, MPN567, MPN507, MPN365, MPN343, MPN290, MPN289, MPN201	lc: 26..87;	member of a family of restriction enzymes; 1.7e-20 till res 326 to M.pulmonis restr. system; exp evidence for M.pulmonis in PNAS 95, 13923 (1998)	MP550	complement(680662..681582)
MPN286	341636..343033	A65_orf465V	g1674246	A65_orf465V	conf, see: MP013					MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN409, MPN370, MPN202	lc: 20..37 59..71 111..131 157..171 257..281 389..401;		MP549	complement(679162..680559)
MPN287	343764..344120	A65_orf118	g1674245	A65_orf118	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URFexp: RNA data from ZMBH, RNA-expressed;	MP548	complement(678075..678431)
MPN288	344716..347079	A65_orf787o	g1674244	A65_orf787o	see: MP631 conserved hypothetical					MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN364, MPN363, MPN284, MPN282, MPN281, MPN200, MPN199	sp: 1..27; cc: 537..557; lc: 231..267 467..479;	see comments to MP631. exp: 2D-Gel data from ZMBH TX-UF, auf Gel ca. 31 kD, IEP 5.6; RNA data from ZMBH only once at 32 degrees;	MP547	complement(675116..677479)
MPN289	347169..347732	hsdS1B	g1674243	H10_orf187V	conf, this protein specifications means only that it is a type I restriction with enzyme ecokI specificity protein see: MP335					MPN089, MPN615, MPN507, MPN365, MPN343, MPN290, MPN285, MPN201	lc: 149..166;	family, see main representative MP335	MP546	complement(674463..675026)
MPN290	347871..348308	H10_orf145L	g1674242	H10_orf145L	conf,see: MP335					MPN089, MPN615, MPN507, MPN365, MPN343, MPN289, MPN285, MPN201		family, see main representative MP335	MP545	complement(673887..674324)
MPN291	complement(348301..348891)	H10_orf196	g1674241	H10_orf196	conserved hypothetical				MG208	MPN478		hits only MG counterpart exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP544	673304..673894
MPN292	complement(348875..349804)	yceC	g1674240	H10_orf309	new_conf, similar to RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D				MG209	MPN548	lc: 144..156;	SUB; mart: PFAM: YABO = hypthetical function hits (also links of YABO) to RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D ... hits to experimentaaly confirmed RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D; exp in EC seem VERY significant after one iteration UI 98325071; new_conf tobias MG; exp: RNA data from ZMBH, RNA-expressed;	MP543	672391..673320

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN293	complement(349804..350358)	lsp	g1674239	H10_orf184	conf, prolipoprotein signal peptidase				MG210		sp: 1..47; tm: 92..112 156..176;	20-160 (of 180) indeed true as given prolipoprotein signal peptidase	MP542	671837..672391
MPN294	350397..351017	H10_orf206	g1674238	H10_orf206	new_conf, similar to intracellular protease							Hits after iterations: PFPI_PYRFU a PROTEASE, belonging to the THIJ/PFPI FAMILY PFPI_PYRFU contains hard medline refernce ... but hits many other proteins after that iteration ... (rna binding AND -methyl-5(b-hy droxyethyl -thiazole monophosphate biosynthesis enzyme) ...proteases appaer first by a big significance differnce. actually all the putative functions are one big family ... MP is most similar to protease, seems to fall in that COG (is remotely similar to MP122 (B01_orf108), hydrolase), hits medline 96196168; new_conf, confirmed also by putative intracellular protease, COG 0693;	MP541	complement(671178..671798)
MPN295	351066..351728	H10_orf220L	g1674237	H10_orf220L	conserved hypothetical				MG210.1			only hits the MG ortholog and then CONVERGES ..... REALLY smart: SEG exp: RNA data from ZMBH, RNA-expressed; 2d-Gel-PH: TX-UF. Ges.;	MP540	complement(670467..671129)
MPN296	351728..351910		New identified	New identified	ribosomal protein S21								539-540	complement(670285..670467)
MPN297	351935..352384	H10_orf149	g1674235	H10_orf149	conserved hypothetical				MG211		cc: 53..89;	Only close homolog is from MG. Converges on that one in PSI-blast sub significant hits are all glutamate rich ... and should thus be discarded smart: coils exp: RNA data from ZMBH, RNA-expressed; 2d-Gel-PH: TX-UF;	MP539	complement(669811..670260)
MPN298	352387..352746	H10_orf119	g1674234	H10_orf119	new_conf, similar to holo-acyl-carrier protein synthase				MG211.1			N term part 1-65 hits holo-acyl-carrier protein synthase ... after third ietration hits become full length. also reciprocally it is hit. [FUNCTION] TRANSFERS THE 4'-PHOSPHOPANTETHEINE MOIETY FROM COENZYME A TO THE SER-36 OF ACYL-CARRIER PROTEIN. [CATALYTIC ACTIVITY] COA + APO-[ACYL-CARRIER PROTEIN] = ADENOSINE 3',5'-BISPHOSPHATE + HOLO-[ACYL-CARRIER PROTEIN]. [COFACTOR] REQUI MG(2+). [SUBUNIT] HOMODIMER. IF it is anything it is likely something like this, hits medline 96027548; new_conf, COG0736, acyl carrier protein synthase;	MP538	complement(669449..669808)
MPN299	352734..353534	plsB	g1674233	H10_orf266	conf, 1-acyl-sn-glycerol-3-phosphate acyltransferase			Fatty acid and phospholipid metabolism; Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate;	MG212		sp: 1..39;	confirmed by psi-blast (unless all false annotations or it makes no sense in context) Synonim: LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE (1-ACYLGLYCEROL- 3-PHOSPHATE O-ACYLTRANSFERASE) might be over prediction ????, context ..	MP537	complement(668661..669461)
MPN300	353535..355055	dyr	g1674232	H10_orf506	conf, bidomainal:Dihydrofolate Reductase and C-terminal domain is conserved hypo-thetical	1-157 matches completely Dihydrofolate Reductase; 160-400 matches 21-238 of bacterial family member 250 aa proteins (e.g. YPUG_BACSU); 400-506 no matches appart of MG homolog.	1VDR-A	Biosynthesis of cofactors, prosthetic groups and carrier;Folic acid; but dihyrofolate reductase (DYR) homolog protein; reaction similar to 5,6,7,8-tetrahydrofolate + NADP = 7,8-dihydrofolate + NADPH	MG213	MPN321	cc: 247..269 427..460;	story: N-terminal matches Dihydrofolate Reductase but another part is a bacterial family of hypothetical proteins (multidomain or artifact) exp: RNA data from ZMBH, 32 degrees once, RNA-expressed;	MP536	complement(667140..668660)
MPN301	355039..355665	ypuH	g1674231	H10_orf208	conserved hypothetical				MG214			bacterial family; bacterial family; expandable with PSI-BLAST exp: RNA data from ZMBH, RNA-expressed;	MP535	complement(666530..667156)
MPN302	355685..356671	pfk	g1674230	H10_orf328	conf, 6-phosphofructokinase		3PFK	Energy metabolism, Glycolysis; 6-phosphofructokinase (pfk); fructose 6-phosphate + ATP = Fructose 1,6-biphosphate; note: This twin MP533/MP534 (other glycolysis twin MP213/MP214) - evolutionary implications ? regulation ?	MG215				MP534	complement(665524..666510)
MPN303	356677..358203	pyk	g1674229	H10_orf508	conf, pyruvate kinase		1A3W-A	Energy metabolism, Glycolysis;pyruvate kinase (pyk); phosphoenol pyruvate and ADP = pyruvate + ATP;	MG216				MP533	complement(663992..665518)
Cys-tRNA(TGC)	358241..358319	mptgc											358241..358319	complement(663876..663954)
Pro-tRNA(CCA)	358371..358447	mptgc											358371..358447	complement(663748..663824)
Met-tRNA(ATG)	358456..358528	mptgc											358456..358528	complement(663667..663739)
Ile-tRNA(ATG)	358539..358614	mptgc			in Genbank, /note="codon recognized: CAT" is wrong.								358539..358614	complement(663581..663656)
Ser-tRNA(TCA)	358655..358745	mptgc											358655..358745	complement(663450..663540)
fMet-tRNA(ATG)	358758..358834	mptgc			in Genbank, /product="tRNA-Met" is wrong.								358758..358834	complement(663361..663437)
Asp-tRNA(GAC)	358836..358909	mptgc			in Genbank, /product="tRNA-Asn" is wrong.								358836..358909	complement(663286..663359)
Phe-tRNA(TTC)	358911..358986				in Genbank, "gene" missing. Maybe gene = "mptgc"								358911..358986	complement(663209..663284)
MPN304	359183..359899	arcA	g1674228	H10_orf238	less, (N-terminal, fragment)			Energy metabolism; Amino acids and amines; N-terminal fragment; arginine + H2O = citrullin + NH3; note with MP531 above only; there is another arginine deiminase or arginine dehydrolase at MP 282;		MPN560		matches ARCA_MYCAR 4-194; exp: Chromosomal and other re-sequencing suggests that this frameshift is real; the fragments here are probably pseudogenes (subsequent loss) and/or in the process of acquiring a new function	MP532	complement(662296..663012)
MPN305	359800..360396	arcA	g1674227	H10_orf198	less, (C-terminal, fragment)			Energy metabolism; Amino acids and amines; C-terminal fragment; arginine + H2O = citrullin + NH3		MPN560		matches ARCA_MYCAR 210-407; exp: Chromosomal and other re-sequencing suggests that this frameshift is real; there is MP282 as a complete arginine deiminase; the fragments here are probable pseudogenes(subsequent loss) and/or in the process of acquiring a new function	MP531	complement(661799..662395)
MPN306	360644..361465	argI	g1674226	H10_orf273o	less (fragment)		1A1S	Energy metabolism, Amino acids and amines; if the first 70 AA do not matter (see comment) this works as ornithine carbamoyl transferase (otc1); carbamoyl-phosphate + ornithine = phosphate + citrulline;				first 70 aa of the ornithine carbamoyl transferase are not matched (sequence-error?); Mikita has an N-terminal extension;	MP530	complement(660730..661551)
MPN307	361468..362397	arcC	g1674225	F10_orf309	conf, carbamate kinase (EC 2.7.2.2)			Energy metabolism, Amino acids and amines; carbamate kinase; ATP + NH3 + CO2 = ADP + carbamoyl-phosphate;			lc: 185..191 287..300;		MP529	complement(659798..660727)
MPN308	362400..364097	F10_orf565	g1674224	F10_orf565	new_conf, aa_permeases see: MP058			Transporters, probably APC family like; amino acid permease		MPN096, MPN095	sp: 1..23; tm: 43..63 95..115 137..157 172..192 227..247 268..288 311..331 371..391 424..444 460..480 515..535;	new_conf; Pfam:aa_permeases (Evalue - 0.64) See pfam alignment. further confirmed by COG531	MP528	complement(658098..659795)
MPN309	364231..365448	P65	g1674222	F10_orf405	conserved hypothetical				MG217	MPN452	cc: 253..319; lc: 52..72;	less: P65 is not a function, it is hypothetical; only homologs in MP and MG exp: RNA data from ZMBH, RNA-expressed; part of the cytadherence regulatory locus protein with MW 65 kDa. cytadherence operon-like	MP527	complement(656747..657964)
MPN310	365468..370924	F10_orf1818	g1674221	F10_orf1818	new_conf, Cytadherence High Molecular Weight Protein 2 (SwissProt HMW2_MYCPN)				MG218	MPN474, MPN387	cc: 39..69 102..177 256..285 314..562 618..865 926..1068 1173..1273 1367..1416 1503..1606 1644..1755 1787..1814; lc: 1756..1784;	new_conf; this protein is HMW2_MYCPN 97252497 J. BACTERIOL. 179:2668-2677(1997); koonin said only coiled coil; most of the protein is coiled coil; hmw2 recognized also by Sternberg, GenebankMG and swissprot; note that this protein is the center of the crl, the cytadherence regulatory locus; Hedreyda and Krause, 1995; Infect.Immun 63, 3479-3483. Tn4001 insertions in crl have a polar effect on the expression of flanking genes and also result in loss of HMW1 and HMW3 and a cytadherence negative phenotype; cytadherence operon-like;	MP526	complement(651271..656727)
MPN311	370939..372012	F10_orf357	g1674220	F10_orf357	conserved hypothetical				MG218.1		cc: 196..220; lc: 57..70 289..317;	only a MG homolog exp: RNA data from ZMBH, 32 degrees,RNA-expressed; cytadherence regulatory locus protein with MW 41 kDa; cytadherence operon-like	MP525	complement(650183..651256)
MPN312	372002..372658	F10_orf218	g1674219	F10_orf218	hypothetical						lc: 107..132;	no homologue; URF, although according to Krause et. al. J. Bact 1997 2668-2677 there is a protein expressed (bs); exp: RNA data from ZMBH, RNA-expressed; cytadherence regulatory locus protein with MW 24 kDa; cytadherence operon-like	MP524	complement(649537..650193)
MPN313	complement(372741..373013)	F10_orf90	g1674218	F10_orf90	conserved hypothetical				MG220	MPN207	tm: 12..32;	Only homolog in MG by PSI-BLAST; Homolog in MG, GeneBank and TYGR say pre-procytotoxin (?), Koonin says hypothetical exp: RNA data from ZMBH, 32 degrees,RNA-expressed;	MP523	649182..649454
Arg-tRNA(CGC)	373083..373159	mptgac											373083..373159	complement(649036..649112)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN314	373414..373839	yabB	g1674217	F10_orf141b	conserved hypothetical				MG221			Conserved bacterial family exp: RNA data from ZMBH, RNA-expressed;	MP522	complement(648356..648781)
MPN315	373829..374755	yabC	g1674216	F10_orf308	new_conf, SAM-Dependent Methytransferase (Koonin for MG ortholog)				MG222		lc: 180..192;	new_conf Koonin for MG ortholog; 2nd PSI-BLAST iteration hits characterized members MTA1_ACICA 91345839 Agric. Biol. Chem. 55 (6), 1553-1559 (1991); exp MTA1_ACICA 91345839 exp: RNA data from ZMBH, RNA-expressed;	MP521	complement(647440..648366)
MPN316	374758..376017	F10_orf419	g1674215	F10_orf419	conserved hypothetical				MG223		lc: 328..342;	only MP MG exp: RNA data from ZMBH,RNA-expressed;	MP520	complement(646178..647437)
MPN317	376023..377165	ftsZ	g1674214	F10_orf380	conf, cell division protein FtsZ		1FSZ		MG224			exp: RNA data from ZMBH only once low at 32 degrees, is hypothetical ! Why: Because only activated at cell division.	MP519	complement(645030..646172)
MPN318	377208..378683	F10_orf491	g1674213	F10_orf491	conf,(amino acid permease)			Transporters, APC family; amino acid permease;	MG225	MPN319	tm: 12..32 39..59 98..118 129..149 163..183 203..223 241..261 288..308 347..367 380..400 421..441 453..473;	homologue to MP517 exp: RNA data from ZMBH,RNA-expressed;	MP518	complement(643512..644987)
MPN319	378658..380169	gap1	g1674212	F10_orf503	conf, general amino acid permease GAP1 homolog; similar to Swiss-Prot Accession Number P19145, from S. cerevisiae			Transporters, APC family; amino acid permease;	MG226	MPN318	tm: 20..40 46..66 106..126 136..156 166..186 210..230 247..267 301..321 360..380 406..426 443..463 468..488;	homologue to MP518	MP517	complement(642026..643537)
MPN320	380541..381527	thyA	g1674210	F10_orf328	conf, thymidylate synthase		1AN5-A		MG227			Bairoch: Protein starts in fact at MQQYLDLARYVLEHGKYRP ... so about 40 aa shorter at N-terminus; Mikita sees again only a one bp intergenic region (but not more).	MP516	complement(640668..641654)
MPN321	381529..382011	dhfr	g1674209	F10_orf160	conf, dihydrofolate reductase (EC 1.5.1.3)		1DDR-A	Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; dihydrofolate reductase (dhfr); 5,6,7,8-tetrahydrofolate + NADP = 7,8-dihydrofolate + NADPH;	MG228	MPN300			MP515	complement(640184..640666)
MPN322	382018..383037	nrdF	g1674208	F10_orf339	more_, ribonucleoside-diphosphate reductase beta chain		1MRR-A	Purines, pyrimidines, nucleosides and nucleotides, 2'-Deoyribonucleotide metabolism; ribonucleoside-diphosphate reductase (nrdE); requires further subunit, but MP514 is in such an operon, see comment; 2'-deoxyribonucleoside diphosphate + oxidized thioredoxin +H2O = ribonucleoside diphosphate + reduced thioredoxin;	MG229		lc: 178..192;	more_ beta subunit; sub: ribonucleoside-diphosphate reductase; operon MP512/MP513/MP514	MP514	complement(639158..640177)
MPN323	383040..383501	F10_orf153	g1674207	F10_orf153	new_conf, probably nrdI				MG230			tentative but part of a ribonucleoside-diphosphate reductase operon present also in E. coli, B. subtilis, S. typhimirium, L. lactis, etc; homolog (no function) NRDI_BACSU 97124182 MICROBIOLOGY 142:2995-3004(1996) operon MP512/MP513/MP514; operon comparison in 98136125 J. Biol. Chem. 273:4329-4337(1998) Figure 2; COG1780; Sternberg; exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP513	complement(638694..639155)
MPN324	383525..385690	nrdE	g1674206	F10_orf721	more_, ribonucleoside-diphosphate reductase alpha chain		5R1R-A	Purines, pyrimidines, nucleosides and nucleotides, 2'-Deoyribonucleotide metabolism; ribonucleoside-diphosphate reductase (nrdE); requires further subunit, but MP512 is in such an operon, see comment; 2'-deoxyribonucleoside diphosphate + oxidized thioredoxin +H2O = ribonucleoside diphosphate + reduced thioredoxin;	MG231			more_ alpha subunit; sub: ribonucleoside-diphosphate reductase; operon MP512/MP513/MP514	MP512	complement(636505..638670)
MPN325	385837..386139	rpl21	g1674205	F10_orf100b	conf, ribosomal protein L21				MG232			SUB; sub: ribosomal	MP511	complement(636056..636358)
MPN326	386132..386434	ysxB	g1674204	F10_orf100a	conserved hypothetical				MG233		tm: 24..44;	small bacterial family with members in MP MG B. subtilis and T. pallidum exp: RNA data from ZMBH, RNA-expressed;	MP510	complement(635761..636063)
MPN327	386427..386741	rpl27	g1674203	F10_orf104	conf, ribosomal protein L27				MG234			SUB; sub: ribosomal	MP509	complement(635454..635768)
MPN328	386734..387594	nfo	g1674202	F10_orf286	conf, endonuclease IV		1DID-A, 1BHW-A		MG235				MP508	complement(634601..635461)
MPN329	387548..388024	F10_orf158	g1674201	F10_orf158	new_conf, Ferric uptake regulator (Koonin for MG homologue)				MG236			new_conf (Koonin for MG homologue); exp 98164360 FUR_HELPY	MP507	complement(634171..634647)
MPN330	388014..388898	F10_orf294	g1674200	F10_orf294	conserved hypothetical				MG237			exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP506	complement(633297..634181)
MPN331	388923..390257	tig	g1674199	F10_orf444	conf, trigger factor		1BKF		MG238			exp,expPH: N-terminal sequence was MKQYNTDNTE [instead of of predicted MKQYKLVNTTQKE] 2D Gel weight was 55kD instead of 51kD predicted	MP505	complement(631938..633272)
MPN332	390328..392715	lon	g1674198	F10_orf795	conf, ATP-dependent protease Lon		1D2N-A		MG239	MPN271	lc: 33..47 304..308 591..604;		MP504	complement(629480..631867)
MPN333	392910..395162	F10_orf750	g1674196	F10_orf750	hypothetical see: MP501					MPN491, MPN335	sp: 1..49; tm: 79..99 118..138 143..163 724..744; cc: 546..587;	less: no homolog appart from MP503; no idea from where the original annotation came; exp: RNA data from ZMBH, RNA-expressed;	MP503	complement(627033..629285)
MPN334	395165..396145	bcrA	g1674195	F10_orf326	new_conf, ABC transporter ATP-binding protein			Transporter, ABC family, function ?;		MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN416, MPN258, MPN218, MPN217, MPN194, MPN193		new_conf pfam 35-215 Pfam:ABC_tran; C-terminal 80 residues not conserved (not even in MG), probably missing stop codon; exp 96146051 ECSA_BACSU	MP502	complement(626050..627030)
MPN335	396132..398357	F10_orf741	g1674194	F10_orf741	hypothetical see: MP503					MPN491, MPN333	tm: 38..58 73..93 120..140 157..177 185..205 715..735; cc: 404..431 626..647; lc: 222..234 440..467 552..566 603..625;	less: no homolog appart from MP503; no idea from where the original annotation came; exp: RNA data from ZMBH, RNA-expressed;	MP501	complement(623838..626063)
MPN336	complement(398358..399392)	F10_orf291	g1674193	F10_orf291	new_conf, bidomain: nucleotidyl transferase and conserved hypo-thetical second domain, probably phosphopantetheine adenylyltransferase activity	1-130 conserved archaeal/bacterial proteins with similarity to LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN and nucleotidyl transferases; 131-291 family of archaeal/bacterial proteins of unknown function		Fatty acid and phospholipid metabolism; phosphopantetheine adenylyltransferase (rate limiting step in CoA synthesis) ATP + pantetheine 4'phosphate <-> diphosphate + dephospho-Coenzyme A (CoA)	MG240		lc: 265..277;	new_conf; N-terminal family of archaeal/bacterial proteins with similarity to nucleotidyl transferases and "LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS (exact function see below)" PROTEIN KDTB PSI-BLAST kdtb_ecoli 92250420 J. BACTERIOL. 174:3250-3260(1992); story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon; further support: common regulation of mRNA expression) exp: RNA data from ZMBH, 32 degrees, RNA-expressed; Note: The operon is overall very similarly expressed, around 400 at 32 degrees, good exp. argument; cog1713 (given in the MG re-annotation update) is "Uncharacterized BCR"; however COG1057 (latest COG page) confirms the nucleotidyl transferase prediction. Exp. Data by Iszard and Geerlof (1999) EMBO show exact function of ktdb E.coli is phosphopantetheine adenylyltransferase; this could use the 4'phosphopantehteine created by the acyl carrier protein phospho diesterase (MP362). Participation in lipid metabolism via this CoA link	MP500	622962..623837
MPN337	399477..401342	F10_orf621	g1674192	F10_orf621	conserved hypothetical				MG241	MPN338	tm: 588..608; lc: 247..262 480..496;	story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP499	complement(620853..622718)
MPN338	401345..403243	F10_orf632o	g1674191	F10_orf632o	conserved hypothetical				MG242	MPN337	tm: 571..591 603..623; cc: 322..355;	story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP498	complement(618952..620850)
MPN339	403243..403917	H91_orf224	g1674190	H91_orf224	conserved hypothetical						sp: 1..47; tm: 54..74 108..128 153..173;	story MP497/MP498/MP499/MP500 proteins and order conserved in MG (operon?) exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP497	complement(618278..618952)
MPN340	403921..405510	pcrA	g1674189	H91_orf529	conf,DNA helicase II		1PJR			MPN341	tm: 506..526;	less; Similar to previous one but without the C-terminal domain; Pfam:UvrD-helicase 5-469 exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP496	complement(616685..618274)
MPN341	405573..407720	mutB1	g1674187	H91_orf715	more__, DNA helicase II (with Mycoplasma specific C-terminal domain)	1-620 similarity to DNA helicases II, PCRA_STAAU 94049679 Mol. Gen. Genet. 241 (1-2), 185-192 (1993); 640-728 uncharacterised C-terminal domain specific of MP, MG and the shorter UVRD_MYCCA 94075343 J. Biol. Chem. 268 (35), 26531-26540 (1993)	1PJR		MG244	MPN340	cc: 575..599; lc: 680..692;	Pfam:UvrD-helicase 10-488; exp PCRA_STAAU 94049679; better: E.coli 92358234 uvrD helicase II e-64 full protein, but story: this sequence has a domain specific of Mycoplasma which is not described, moreover the M capricolum protein has a different domain organization; annotation of UVRD_MYCCA could be wrong, it only matches part of DNA helicases II	MP495	complement(614475..616622)
MPN342	407861..409492	hsdM	g1674186	H91_orf543	conf, type I restriction enzyme HsdM		1YUB			MPN352		sub: type I restriction system; subunit M of type I restriction system; exp 89178628 T1M1_ECOLI	MP494	complement(612703..614334)
MPN343	409871..410863	H91_orf330	g1674185	H91_orf330	conf,see: MP335					MPN089, MPN615, MPN567, MPN507, MPN365, MPN290, MPN289, MPN285, MPN201	lc: 46..111;	family, see main representative MP335	MP493	complement(611332..612324)

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN344	411086..411736	H91_orf216	g1674184	H91_orf216	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 173..215; lc: 66..93;	URF exp: RNA data from ZMBH, RNA-expressed;	MP492	complement(610459..611109)
MPN345	412681..413301	hsdR	g1674183	H91_orf206	conf,Type I Restriction Enzyme (fragment)							MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 104-299	MP491	complement(608894..609514)
MPN346	413431..413778	H91_orf115	g1674182	H91_orf115	new, Type I Restriction Enzyme hsdR (fragment)							new; MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 339-434; sub: type I restriction system; fragment of subunit R of the type I restriction system exp: RNA data from ZMBH, no expression, still hypothetical;	MP490	complement(608417..608764)
MPN347	413985..415115	hsdR	g1674181	H91_orf376	conf,Type I Restriction Enzyme (fragment)					MPN398	cc: 152..184; lc: 279..291;	MP489/MP490/MP491 must be either a sequencing error or a pseudogene; similar to O25517 from H pylori (866 aa) 513-757; sub: type I restriction system; fragment of subunit R of the type I restriction system	MP489	complement(607080..608210)
MPN348	416070..416564	H91_orf164	g1674179	H91_orf164	conf, 5-formyl tetrahydrofolate cyclo-ligase (HI0858) homolog; similar to GenBank Accession Number D64160, from H. influenzae			Biosynthesis of cofactors, prosthetic groups and carrier; Folic acid; 5-formyl tetrahydrofolate cyclo-ligase; ATP + 5-formyltetrahydrofolate = ADP + P + 5,10-methenyltetrahydrofolate	MG245			exp: RNA data from ZMBH, no expression, still hypothetical;	MP488	complement(605631..606125)
MPN349	416554..417399	H91_orf281	g1674178	H91_orf281	conserved hypothetical				MG246			conserved family of bacterial hypothetical proteins exp: RNA data from ZMBH, RNA-expressed; suggestion STRING-server: Nucleotidase	MP487	complement(604796..605641)
MPN350	complement(417391..418110)	ygiH	g1674177	H91_orf239	conserved hypothetical	transmembrane (3?)			MG247	MPN579	sp: 1..22; tm: 68..88 99..119 136..156 159..179 199..219;	Conserved family of hypothetical proteins; Alignment shows 4 blocks of conservation separated by 3 hydrophobic (TM?) regions; Koonin says permease for MG homolog, I cannot see it; interesting ECOLI hypothetical prot homolog YGIH_ECOLI 205 aa and HI exp: RNA data from ZMBH, RNA-expressed;	MP486	604085..604804
MPN351	complement(418116..418757)	H91_orf213	g1674176	H91_orf213	new_conf, methyltransferase	10-53 matches to methyltransferase profile; rest no matches to functionally characterized proteins			MG248			new_conf (Koonin); Closer is RRMA_ECOLI 98101475 J. BACTERIOL. 180:359-365(1998); psi-blast with 73-126 of RRMA_ECOLI hits MP485, inclusion of MP485 (Y248_MYCPN) in profile brings methyltranferases in; exp RRMA_ECOLI 98101475	MP485	603438..604079
MPN352	complement(418741..420240)	sigA	g1674175	H91_orf499	less, Sigma-70 Factor Family	1-240 No homolog appart of MG; 240-480 Sigma-70 Factor Family	1SIG	degraded by FtsH (?)	MG249		lc: 127..141;	less original annotation could be overprediction; exp RPSA_BACSU (371 aa) J. BIOL. CHEM. 260:7178-7185(1985); Pfam:sigma70 246-480; sub: RNA polymerase	MP484	601955..603454
MPN353	complement(420293..422155)	dnaE	g1674174	H91_orf620	conf, DNA primase	last 100 aa no homology appart of MG			MG250	MPN014	lc: 437..453;	Pfam:tRNA-synt_2b 58-430	MP483	600040..601902
MPN354	complement(422139..423488)	grs1	g1674173	H91_orf449	conf, glycyl-tRNA synthetase		1ATI-A		MG251	MPN553		ok	MP482	598707..600056
MPN355	complement(423510..424238)	yacO	g1674172	H91_orf242a	more_, tRNA/rRNA methyltransferase (fragment?)	1-90 Has no homologs appart from MG; 90-242 tRNA/rRNA methyltransferase			MG252	MPN521		more_ tRNA/rRNA methyltransferases; Pfam:SpoU_methylase 95-238; large family of uncharacterized proteins except one: PT56_YEAST (421 aa); This one is matched only partially (MP481 has 242 aa) 89-237 to 235-405.; exp PT56_YEAST 86093663 NUCLEIC ACIDS RES. 13:8587-8601(1985) exp: RNA data from ZMBH, no expression, still hypothetical;	MP481	597957..598685
MPN356	complement(424241..425554)	cysS	g1674171	H91_orf437	conf, cysteinyl-tRNA synthetase		1GLN		MG253		lc: 70..80 346..356;	ok	MP480	596641..597954
MPN357	complement(425535..427511)	lig	g1674170	H91_orf658	conf, DNA ligase				MG254			conf,exp: RNA data from ZMBH, no expression, is hypothetical; (clear case for repeating expression measurements under a stress condition)	MP479	594684..596660
Gly-tRNA(GGC)	complement(427575..427647)	mptgg			Is mptgg correct? See Trp-tRNA(TGG) above.								complement(427575..427647)	594548..594620
MPN358	427679..429283	H91_orf534	g1674169	H91_orf534	conserved hypothetical				MG255; MG255.1		tm: 182..202; lc: 104..123 150..162;	conf,exp: RNA data from ZMBH, RNA-expressed;	MP478	complement(592912..594516)
Trp-tRNA(TGG)	429432..429505	mptgg			Is mptgg correct? See Gly-tRNA(GGC) below.								429432..429505	complement(592690..592763)
MPN359	429513..430289	H91_orf258	g1674168	H91_orf258	conserved hypothetical				MG256		tm: 41..61 72..92;	only MG and MP exp: RNA data from ZMBH, RNA-expressed;	MP477	complement(591906..592682)
MPN360	430334..430627	rpmE	g1674167	H91_orf97	conf, ribosomal protein L31				MG257			SUB; sub: ribosomal	MP476	complement(591568..591861)
MPN361	430628..431707	prfA	g1674166	H91_orf359V	conf, peptide chain release factor 1				MG258		cc: 59..102;	ok	MP475	complement(590488..591567)
MPN362	431707..433068	H91_orf453	g1674165	H91_orf453	new, hemk family, similar to methyltransferase (S-adenosyl-methionine dependent)	66-254 similar to N-6 Adenine-specific DNA methylase	1AQI-A	intermediay metabolism; methyltransferase (perhaps for adenine ?)	MG259		lc: 140..155;	N-terminal half (till aa 217) domain (I checked that the low cplx region inbetween is contained) is clear member of the hemK family (psi-blast, directly, e-11, many members) protoporphyrinogen oxidase is not confirmed biochemically. This is a protein of the hemK family, but new biochemical data show now clearly no (!) involvment in porphyrine synthesis, instead by sequence similarity S-adenosyl-methionine-dependent methyltransferase suggested. PMID: 10220893, UI: 99237242. N-6 adenine specific DNA methyltransferase is both similar in sequence and structure. The C-terminus is conserved hypothetical (MG,MP, Thermotoga maritima; converged) exp: RNA data from ZMBH, only once 32 degrees, low;	MP474	complement(589127..590488)
MPN363	433200..433508	H91_orf102	g1674164	H91_orf102	see: MP631 conserved hypothetical					MPN152, MPN146, MPN097, MPN506, MPN408, MPN336, MPN288, MPN284, MPN281, MPN200, MPN199	sp: 1..27;	see comments to MP631.	MP473	complement(588687..588995)
MPN364	433547..435580	H91_orf677	g1674163	H91_orf677	see: MP631 conserved hypothetical					MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN408, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199	lc: 110..137 361..389;	see comments to MP631.	MP472	complement(586615..588648)
MPN365	435924..436730	H91_orf268	g1674161	H91_orf268	conf,see: MP335					MPN089, MPN615, MPN507, MPN343, MPN290, MPN289, MPN285, MPN201		family, see main representative MP335	MP471	complement(585465..586271)
MPN366	436814..437632	H91_orf272	g1674160	H91_orf272	new_conf, see: MP012 involved in cytadherence					MPN149, MPN142, MPN503	lc: 43..58 72..88 222..237;	exp: RNA data from ZMBH, RNA-expressed;	MP470	complement(584563..585381)
MPN367	437563..438531	H91_orf322	g1674159	H91_orf322	new_conf, see: MP012 involved in cytadherence					MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN464, MPN414	lc: 3..30 244..257;	exp: RNA data from ZMBH, RNA-expressed;	MP469	complement(583664..584632)
MPN368	439220..439762	H91_orf180	g1674158	H91_orf180	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204	cc: 69..122;	URF exp: RNA data from ZMBH, RNA-expressed;	MP468	complement(582433..582975)
MPN369	complement(439894..440655)	H91_orf253	g1674157	H91_orf253	see: MP199, conserved hypothetical					MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN411, MPN271	sp: 1..31;		MP467	581540..582301
MPN370	441296..443509	A19_orf737V	g1674156	A19_orf737V	conf, see: MP013					MPN144, MPN141, MPN132, MPN131, MPN101, MPN099, MPN502, MPN500, MPN468, MPN409, MPN286, MPN205, MPN202	sp: 1..20; tm: 590..610; lc: 59..76 93..105 146..163 421..435 461..474 536..548;		MP466	complement(578686..580899)
MPN371	complement(443552..444187)	A19_orf211	g1674155	A19_orf211	hypothetical						lc: 122..135;	URF exp: RNA data from ZMBH, RNA-expressed;	MP465	578008..578643

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN372	444341..446116	A19_orf591	g1674154	A19_orf591	new, similarity to pertussis toxin subunit s1	1-240 similar to pertussis toxin subunit s1 (270 aa)	1BCP-A					new; no pfam; sub: pertussis toxin	MP464	complement(576079..577854)
MPN373	complement(446127..446741)	A19_orf204	g1674153	A19_orf204	hypothetical see: MP460					MPN376	lc: 158..176;	similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed;	MP463	575454..576068
MPN374	complement(447770..448459)	A19_orf229V	g1674151	A19_orf229V	hypothetical see: MP460					MPN376	cc: 73..106;	similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed;	MP462	573736..574425
MPN375	complement(448805..449194)	A19_orf129	g1674150	A19_orf129	hypothetical see: MP460					MPN376		similar to part of MP460; URF exp: RNA data from ZMBH, RNA-expressed;	MP461	573001..573390
MPN376	complement(449573..452995)	A19_orf1140	g1674149	A19_orf1140	hypothetical					MPN375, MPN374, MPN373	sp: 1..26; lc: 272..284;	No homology out of MP; MP461, MP462 and MP463 are similar to consecutive parts of this one; URF exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH TX-UF, Ges. auf Gel bei ca. 12kD (N-term.) Gel 157 bei ca. 31kD in bas. Rand;	MP460	569200..572622
Arg-tRNA(CGA)	complement(453260..453334)	mptga											complement(453260..453334)	568861..568935
MPN377	453422..453646		A19_orf74	A19_orf74	hypothetical								MPN377	complement(568549..568773)
MPN378	453650..456268	dnaE	g1674148	A19_orf872	conf, DNA polymerase III alpha subunit	1-100 DP3A_ECOLI PSI-BLAST iter-3 Identities = 29/101 (28%) J. Bacteriol. 169 (12), 5735-5744 (1987); 100-260 exclusive of DP3A_MYCPN DP3A_MYCGE; 260-780 DP3A_ECOLI FASTA 34.7% identities, length = 574; 780-872 unique of DP3A_MYCPN DP3A_MYCGE			MG261	MPN034	lc: 157..163;	story It has a different domain organization than other DP3As; No PFAM; Note the different domain organization; exp DP3A_ECOLI 88058791; DP3A_ECOLI has domains not present in this one!; sub: DNA polimerase III	MP459	complement(565927..568545)
MPN379	456272..457147	polA	g1674147	A19_orf291	less, 5'-3' exonuclease (complete)		1BGX-T		MG262	MPN658		less It is not a fragment of a DNA polymerase I but a complete 5'-3' exonuclease; PF01367 5_3_exonuclease; exp EX9_ECOLI 98256427 NUCLEIC ACIDS RES. 26:2593-2597(1998) 26.2% identities, length = 221 SwissProt annot CONF,but gene name still polA exp: RNA data from ZMBH only once at 32 degrees, doubtful;	MP458	complement(565048..565923)
MPN380	457147..457980	fpg	g1674146	A19_orf277	conf, formamidopyrimidine-DNA glycosylase				MG262.1			PF01149 Formamidopyrimidine-DNA glycosylase; exp FPG_LACLC 37.1% identities, length = 275 MICROBIOLOGY 141:411-417(1995)	MP457	complement(564215..565048)
MPN381	458126..459004	yidA	g1674144	A19_orf292	new_conf, HAD superfamily hydrolase/phosphatase				MG263	MPN383		new_conf Koonin; PFAM DUF3 exp: RNA data from ZMBH, RNA-expressed;	MP456	complement(563191..564069)
MPN382	458998..459600	A19_orf200	g1674143	A19_orf200	conserved hypothetical				MG264			hypothetical family; Pfam:UPF0038 exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP455	complement(562595..563197)
MPN383	complement(459530..460378)	yidA	g1674142	A19_orf282	new_conf, HAD superfamily hydrolase/phosphatase				MG265	MPN427, MPN381, MPN264		new_conf Koonin; alignment PFAM DUF3 bacterial domain of unknown function exp: RNA data from ZMBH, RNA-expressed;	MP454	561817..562665
MPN384	complement(460381..462762)	leuS	g1674141	F11_orf793o	conf, leucyl-tRNA synthetase				MG266	MPN023, MPN520, MPN480			MP453	559433..561814
MPN385	complement(462763..463107)	F11_orf114	g1674140	F11_orf114	conserved hypothetical				MG267		sp: 1..19; tm: 76..96;	MP MG specific exp: RNA data from ZMBH, RNA-expressed;	MP452	559088..559432
MPN386	complement(463142..463831)	yaaF	g1674139	F11_orf229	more__, DEOXYGUANOSINE KINASE/ DEOXYADENOSINE KINASE		1UKY		MG268		lc: 47..60;	new_add: 2.7.1.113. The molecular function on the left is more specific than Sternberg nucleotide kinase and than genebankMG cons hyp exp: RNA data from ZMBH, RNA-expressed;	MP451	558364..559053
4.5S_RNA	complement(463876..463954)	No info			S76009 has more 5'-34 and 3'-21 residues comparing to ZMBH www page, but scRNA corresponds to 35-113 of S76009. Then the length is the same as ZMBH. There is one mismatch between the selected region in the genome sequence and S76009.								complement(463876..463954)	558241..558319
MPN387	complement(463979..465055)	F11_orf358b	g1674138	F11_orf358b	conserved hypothetical				MG269	MPN399, MPN310	cc: 87..273;	coiled coil exp: RNA data from ZMBH, RNA-expressed; 2D-Gel data from ZMBH, TX-UF, Ges.	MP450	557140..558216
MPN388	complement(465048..465434)		New identified	New identified	conserved hypothetical								449-450	557019..557147
MPN389	complement(465427..466446)	lplA	g1674137	F11_orf339	conf, lipoate protein ligase				MG270				MP449	555749..556768
MPN390	complement(466473..467846)	pdhD	g1674136	F11_orf457	conf, dihydrolipoamide dehydrogenase		1LPF-A	Energy metabolism, Pyruvate dehydrogenase; dihydrolipoamide dehydrogenase (pdhD); Dihydrolipoamide + NAD(+) = lipoamide + NADH ;	MG271	MPN051, MPN557, MPN394, MPN240	lc: 86..98 175..184;	dihydrolipoamide dehydrogenase	MP448	554349..555722
MPN391	complement(467847..469055)	pdhC	g1674135	F11_orf402	conf, dihydrolipoamide acetyltransferase component (E2)		1E2O, 1IYU	Energy metabolism, Pyruvate dehydrogenase; dihydrolipoamide acetyltransferase component (E2); Acetyl-CoA + dihydrolipoamide = CoA + S-acetyldihydrolipoamide;	MG272	MPN119, MPN452	lc: 80..118 138..170;	dihydrolipoamide acetyltransferase component (E2)	MP447	553140..554348
MP200_RNA	complement(469102..469312)												complement(469102..469312)	552883..553093
MPN392	complement(469374..470357)	pdhB	g1674134	F11_orf327	conf, pyruvate dehydrogenase E1-beta subunit		1AY0-A	Energy metabolism, Pyruvate dehydrogenase; pyruvate dehydrogenase E1-beta subunit (pdhB); pyruvate + lipoamide = S-acetyldihydrolipoamide + CO2 (with the alpha subunit only)	MG273		lc: 61..77;	E1-beta subunit sub	MP446	551838..552821
MPN393	complement(470379..471455)	pdhA	g1674133	F11_orf358a	conf, Pyruvate dehydrogenase		1AY0-A	Energy metabolism, Pyruvate dehydrogenase; pyruvate dehydrogenase E1-alpha subunit (pdhA); pyruvate + lipoamide = S-acetyldihydrolipoamide + CO2; (with the beta subunit only note: no accident, the NADH oxidase MP444 so close to the pyruvate dehydrogenase; sense/ story ?	MG274	MPN082		E1-alpha subunit sub	MP445	550740..551816
MPN394	complement(471476..472915)	nox	g1674132	F11_orf479	conf, NADH oxidase		1BHY	Energy metabolism, Aerobic; NADH oxidase (nox); NADH + H(2)O(2) = NAD + 2 H2O ; hemolysin; pathogenicity factor;	MG275	MPN390			MP444	549280..550719
MPN395	complement(472983..473516)	apt	g1674131	F11_orf133	conf, adenine phosphoribosyltransferase		1A3C	Nucleotide and deoxynucleotide degradation or rescue reaction. adenine phosphoribosyltransferase; AMP + pyrrophosphate = Adenine + phosphoribosylpyrrophosphate.	MG276	MPN073		extend gene to 5' GTG start conf,Mikita found this N-terminal extension, so in fact MKQKLQALDRAIKRFNDFPTPGILFYDITPIFLNSELFEFVLEQ before MAQFIQEVKADGIVCP..., but Bairoch (P75388) not; Richard Hermann SEES this N-terminal extension also in his gels.	MP443	548811..549212
MPN396	complement(473551..476466)	F11_orf887	g1674129	F11_orf887	new, protein export, secD like				MG277		tm: 432..452 462..482 485..505 534..554 572..592 641..661 678..698 706..726 735..755 793..813 817..837; lc: 66..80 292..307;	secD-like domain in the protein; homologous in psi-blast to B.subtilis secDF (fusion); however, further analysis shows that the secD domain of B.subtilis finds MP442 back in psi-blast significantly (2nd iteration, e-37) and that these are definitely at least secD-like domains. Confirming evidence is available from the strings neighbourhood server (note that there is one big family with secD and F fused in addition to understand better strings server output). Detailed sequence alignment shows clear homology to secD family, but again that the domain is only secD-like.	MP442	545981..548644
MPN397	476470..478671	spoT	g1674128	F11_orf733	more__, p)ppGpp 3'-pyrophosphohydrolase			regulatory function	MG278		cc: 508..530; lc: 489..501;	story: produces ppGpp, mediator for stringent response which binds to the beta subunit of the RNA polymerase (MP236) inhibiting transcription, and in E. coli (98190325) activates the PHO regulon related to phosphate transport - It could do the same in MP with operon MP231-234	MP441	complement(543524..545725)
MPN398	complement(478668..479324)	F11_orf218	g1674127	F11_orf218	conserved hypothetical				MG279		sp: 1..26; tm: 160..180;	exp: RNA data from ZMBH, RNA-expressed;	MP440	542871..543527

MPN	Position	Gene	GI	Orf	Annotation	Domain	Structure	Pathway	MG Ortholog	MP Homolog	Intrinsics	Comments	MP_old	MP_old_Position
MPN399	complement(479324..480187)	F11_orf287	g1674126	F11_orf287	conserved hypothetical				MG280	MPN387	sp: 1..30; tm: 226..246; cc: 68..144;	exp: RNA data from ZMBH, RNA-expressed;	MP439	542008..542871
MPN400	complement(480249..481997)	F11_orf582	g1674125	F11_orf582	conserved hypothetical				MG281		lc: 6..18;	exp: RNA data from ZMBH, RNA-expressed;	MP438	540198..541946
Gly-tRNA(GGA)	complement(482285..482358)				In Genbank, "gene" missing. Maybe gene = "mptrna"								complement(482285..482358)	539837..539910
Leu-tRNA(TTA)	complement(482365..482450)	mptrna											complement(482365..482450)	539745..539830
Lys-tRNA(AAA)	complement(482451..482525)	mptrna											complement(482451..482525)	539670..539744
Gln-tRNA(CAA)	complement(482569..482643)	mptrna											complement(482569..482643)	539552..539626
Tyr-tRNA(TAC)	complement(482649..482735)	mptrna											complement(482649..482735)	539460..539546
MPN401	complement(482765..483247)	greA	g1674124	F11_orf160	conf, transcription elongation factor		1GRJ		MG282				MP437	538948..539430
MPN402	483529..484980	proS	g1674123	F11_orf483	conf, putative prolyl-tRNA synthetase; similar to Swiss-Prot Accession Number P38708, from S. cerevisiae		1ATI-A		MG283		lc: 403..415;		MP436	complement(537215..538666)
MPN403	485125..485493	F11_orf122a	g1674121	F11_orf122a	conserved hypothetical				MG284			exp: RNA data from ZMBH, RNA-expressed;	MP435	complement(536702..537070)
MPN404	485474..486514	F11_orf346	g1674120	F11_orf346	conserved hypothetical				MG285		lc: 219..228;	MG MP specific exp: RNA data from ZMBH, RNA-expressed;	MP434	complement(535681..536721)
MPN405	486521..487114	F11_orf197	g1674119	F11_orf197	conserved hypothetical				MG286		sp: 1..26;	MG MP specific exp: RNA data from ZMBH, RNA-expressed;	MP433	complement(535081..535674)
MPN406	487149..487403	F11_orf84	g1674118	F11_orf84	conf, acyl carrier protein homolog; similar to GenBank Accession Number L43074_3, from S. glaucescens			Fatty acid and phospholipid metabolism; acyl carrier protein;	MG287				MP432	complement(534792..535046)
Trp-tRNA(TGA)	487394..487468	mptgwa											487394..487468	complement(534727..534801)
MPN407	complement(487508..490147)	F11_orf879	g1674117	F11_orf879	new, lipase	Lipase_GDSL: 540-624					sp: 1..36;	exported, Lipase_GDSL domain (PFAM 1.5 E-3 score for a Lipase GDSL domain) , new	MP431	532048..534687
MPN408	490375..492657	F11_orf760	g1674116	F11_orf760	see: MP631, conserved hypothetical					MPN152, MPN147, MPN146, MPN098, MPN097, MPN506, MPN364, MPN363, MPN288, MPN284, MPN282, MPN281, MPN200, MPN199	sp: 1..28;	see comments to MP631. exp: 2D-Gel data from ZMBH, TX-UF, auf Gel mw ca. 25kD, IEP 6.7;	MP430	complement(529538..531820)
MPN409	492730..494331	F11_orf533L	g1674115	F11_orf533L	conf, see: MP013					MPN144, MPN141, MPN132, MPN131, MPN099, MPN500, MPN468, MPN370, MPN286, MPN203, MPN202	lc: 28..45 66..76 111..127 390..402 425..437 452..463;		MP429	complement(527864..529465)
MPN410	494694..495140	F11_orf148o	g1674114	F11_orf148o	hypothetical see: MP141					, MPN139, MPN138, MPN137, MPN130, MPN127, MPN104, , MPN038, MPN013, MPN010, MPN655, MPN524, MPN504, MPN501, MPN410, MPN368, MPN344, MPN287, MPN283, MPN204		URF exp: RNA data from ZMBH, RNA-expressed;	MP428	complement(527055..527501)
MPN411	complement(495282..496040)	A05_orf252	g1674113	A05_orf252	see: MP199; conserved hypothetical					MPN148, MPN054, MPN012, MPN011, MPN654, MPN650, MPN649, MPN647, MPN646, MPN644, MPN643, MPN642, MPN641, MPN640, MPN639, MPN505, MPN467, MPN466, MPN369, MPN271	sp: 1..31;		MP427	526155..526913
MPN412	496634..497470		A05_orf278	A05_orf278	not in Genbank, but in the ZMBH list								426.2	complement(524725..525561)
MPN413	497547..497966		A05_orf139	A05_orf139	not in Genbank, but in the ZMBH list								426.1	complement(524229..524648)
MPN414	498076..499557	A05_orf493	g1674111	A05_orf493	see: MP012, new_conf, involved in cytadherence					MPN150, MPN149, MPN142, MPN102, MPN093, MPN092, MPN503, MPN468, MPN464, MPN367	lc: 44..61 252..265;	exp: RNA data from ZMBH, 32 degrees, RNA-expressed;	MP426	complement(522638..524119)
MPN415	499808..500950	P37	g1674110	A05_orf380V	conf, high affinity transport system protein P37			Transporter, ABC superfamily; function ?	MG289		sp: 1..30;		MP425	complement(521245..522387)
MPN416	500943..501677	P29	g1674109	A05_orf244	conf, ATP-binding protein P29			Transporter, ABC superfamily; function ?	MG290	MPN134, MPN081, MPN055, MPN019, MPN018, MPN685, MPN683, MPN609, MPN433, MPN432, MPN334, MPN258, MPN218, MPN217, MPN194, MPN193			MP424	complement(520518..521252)
MPN417	501670..503298	P69	g1674108	A05_orf542	conf, transport system permease protein P69			Transporter, ABC superfamily; function ?	MG291		sp: 1..42; tm: 76..96 113..133 137..157 208..228 234..254 286..306 351..371 410..430 509..529; lc: 373..394 484..500;		MP423	complement(518897..520525)
MPN418	complement(503299..503721)		New identified	New identified	conserved hypothetical								422-423	518474..518896
MPN419	complement(503721..506423)	alaS	g1674107	A05_orf900	conf, alanyl-tRNA synthetase				MG292		lc: 313..331 616..632 872..886;		MP422	515772..518474
MPN420	complement(506475..507200)	glpQ	g1674106	A05_orf241a	conf, glycerophosphoryl diester phosphodiesterase			Central intermediary metabolism; Other; glycerophosphoryl diester phosphodiesterase (glpQ); glycerophosphodiester + H2O = an alcohol + sn-glycerol 3-phosphate;	MG293	MPN566			MP421	514995..515720
MPN421	complement(507193..508620)	A05_orf475	g1674105	A05_orf475	conf, permease			Transporter, MFS type;	MG294	MPN113, MPN112	tm: 18..38 58..78 88..108 121..141 165..185 201..221 253..273 277..297 319..339 350..370 434..454;	annotated already for MG	MP420	513575..515002
MPN422	complement(508751..509863)	A05_orf370	g1674103	A05_orf370	new_conf, TRNA (5-METHYLAMINOMETHYL-2-THIOURIDYLATE)-METHYLTRANSFERASE.		1GPM-A		MG295	MPN562		new_conf: Is not in genebank, also not in genbankMG (cons hyp); N-type pyrrophosphatase by Sternberg, but as tRNA methyltransferase in Swissprot; exp: RNA data from ZMBH, 32 degrees, RNA-expressed	MP419	512332..513444